Entry information : AlyPrx53
Entry ID 7549
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-07 (Achraf Jemmat)
Peroxidase information: AlyPrx53
Name AlyPrx53
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx53
start..stop
S start..stop
AtPrx53 639 0 1..335 1..335
CagraPrx62 633 0 1..335 1..335
AhalPrx13 629 0 1..335 1..336
AruPrx53-1 625 0 1..335 1..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2547510..2547741 232 N° 2 2547223..2547414 192 N° 3 2546931..2547096 166 N° 4 2546432..2546850 419
complement(join(2546432..2546850,2546931..2547096,2547223..2547414,2547510..2547 741))


exon

Literature and cross-references AlyPrx53
DNA ref. Phytozome 12:   scaffold_6 (2547741..2546432)
Protein sequence: AlyPrx53
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335
PWM (Da):   %s   34879.19  
PI (pH):   %s   4.76
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVTNLPTCDGLFIIGLIVIVSSMFRTSSAQLNATFYSGTCPNASAIVRSTIQQALQSDARIGASLIRLHFHDCFVNGCDASILLDDSGSIQSEKNAGPNANSARGFNVVDNIKTALENACPGVVSCSDVLALASEASVSLAGGPSWTVLLGRRDGLTANLAGANSSIPSPVESLSNITSKFSAVGLNMNDLVALSGAHTFGRARCGVFNNRLFNFSGTGNPDPTLNSTLLSTLQQLCPQNGSVSTITNLDLSTPDAFDNNYFTNLQSNNGLLQSDQELFSTTGSSTIAIVTSFASNQTLFFQAFAQSMINMGNISPLTGSNGENRLDCKKVNGS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 3 introns). Probable sequencing error between GNI and SPL (3'end) => extra 4 nt (agtc) which induce a shift and incorrect prediction from Phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTAACAAATCTTCCTACTTGTGATGGTTTGTTCATCATCGGTCTTATTGTTATCGTTTCTTCAATGTTTAGGACATCATCTGCGCAACTAAACGCAACGTTTTACTCTGGGACT
TGCCCTAACGCCTCTGCCATCGTACGTAGCACTATTCAGCAAGCTCTTCAATCTGATGCAAGAATTGGAGCCAGCCTAATCCGCCTTCATTTTCACGATTGCTTTGTTAAT
GTATACTAA
TCTTTTTCGATGCAACTCTTTTAACATAAAACCCGATTGTTCTGTTTCGCCCTAAACCGCTACTTTGCTTCTTTATTATTCTAAAGGGCTGTGATGCATCGATCTTGCTTGACGACAGTG
GAAGCATCCAGAGCGAGAAGAACGCTGGTCCGAATGCAAACTCAGCTAGAGGATTCAACGTTGTCGATAATATCAAGACTGCCCTTGAAAACGCTTGCCCTGGTGTTGTCTCTTGCTCTG
ACGTTTTAGCCCTTGCCTCAGAGGCCTCTGTATCTTTG
GTAATTACATGTTCTTTGTGAACATATGAAACAAAACATAACTAAAAATTATTGTGGTATAATTCTGTTTTAGTAACAATTA
AAACACGTATATATTTATTAACATATACGTTTGATTATCTTCAGGCAGGAGGGCCATCATGGACTGTATTATTAGGAAGAAGAGATGGTCTCACTGCAAACCTAGCCGGGGCAAATTCGT
CCATTCCTTCTCCGGTCGAAAGTCTTAGCAACATCACATCTAAATTTTCGGCTGTCGGGCTAAATATGAACGATCTAGTTGCCTTATCTG
GTGAGTTCATCTACATATTTAGTTACTTGT
GGCTCAAGTTGAAACAAAACCCTAACGCCAACTTTTGTGGATCGACGTAGGTGCGCATACATTCGGGCGTGCTCGATGTGGAGTGTTCAACAACAGACTATTTAACTTCAGCGGGACAGG
AAATCCCGACCCTACTCTAAACTCAACGCTTCTCAGCACTCTTCAACAACTATGTCCTCAAAACGGCAGCGTATCAACGATCACCAATCTCGATCTGAGCACACCAGATGCGTTCGATAA
CAATTACTTCACCAACCTTCAGAGCAACAATGGGCTTCTTCAGTCAGACCAAGAGCTGTTCTCTACCACCGGTTCATCCACCATCGCGATTGTTACTTCATTTGCAAGTAACCAGACTCT
GTTTTTTCAGGCCTTTGCTCAGTCCATGATCAACATGGGGAATATTAGTCCCTTGACTGGGAGTAATGGAGAGAATAGATTAGACTGTAAGAAGGTTAATGGAAGTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTAACAAATCTTCCTACTTGTGATGGTTTGTTCATCATCGGTCTTATTGTTATCGTTTCTTCAATGTTTAGGACATCATCTGCGCAACTAAACGCAACGTTTTACTCTGGGACT
TGCCCTAACGCCTCTGCCATCGTACGTAGCACTATTCAGCAAGCTCTTCAATCTGATGCAAGAATTGGAGCCAGCCTAATCCGCCTTCATTTTCACGATTGCTTTGTTAAT
GGCTGTGAT
GCATCGATCTTGCTTGACGACAGTGGAAGCATCCAGAGCGAGAAGAACGCTGGTCCGAATGCAAACTCAGCTAGAGGATTCAACGTTGTCGATAATATCAAGACTGCCCTTGAAAACGCT
TGCCCTGGTGTTGTCTCTTGCTCTGACGTTTTAGCCCTTGCCTCAGAGGCCTCTGTATCTTTG
GCAGGAGGGCCATCATGGACTGTATTATTAGGAAGAAGAGATGGTCTCACTGCAAAC
CTAGCCGGGGCAAATTCGTCCATTCCTTCTCCGGTCGAAAGTCTTAGCAACATCACATCTAAATTTTCGGCTGTCGGGCTAAATATGAACGATCTAGTTGCCTTATCTG
GTGCGCATACA
TTCGGGCGTGCTCGATGTGGAGTGTTCAACAACAGACTATTTAACTTCAGCGGGACAGGAAATCCCGACCCTACTCTAAACTCAACGCTTCTCAGCACTCTTCAACAACTATGTCCTCAA
AACGGCAGCGTATCAACGATCACCAATCTCGATCTGAGCACACCAGATGCGTTCGATAACAATTACTTCACCAACCTTCAGAGCAACAATGGGCTTCTTCAGTCAGACCAAGAGCTGTTC
TCTACCACCGGTTCATCCACCATCGCGATTGTTACTTCATTTGCAAGTAACCAGACTCTGTTTTTTCAGGCCTTTGCTCAGTCCATGATCAACATGGGGAATATTAGTCCCTTGACTGGG
AGTAATGGAGAGAATAGATTAGACTGTAAGAAGGTTAATGGAAGTTGA

Retrieve as FASTA