Entry information : AlyPrx69
Entry ID 7550
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx69
Name AlyPrx69
Class Class III peroxidase    [Orthogroup: Prx061]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx69
start..stop
S start..stop
AtPrx69 605 0 1..332 1..331
CagraPrx72 579 0 1..332 1..331
CrubPrx53 575 0 1..332 1..331
ThPrx69 569 0 1..332 1..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 21301487..21301912 426 N° 2 21301199..21301358 160 N° 3 21300658..21301070 413  
complement(join(21300658..21301070,21301199..21301358,21301487..21301912))


exon

Literature and cross-references AlyPrx69
DNA ref. Phytozome 12:   scaffold_8 (21301912..21300658)
Protein sequence: AlyPrx69
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (309)
PWM (Da):   %s   35907.76 (33429.4) Transmb domain:   %s   i7-26o
PI (pH):   %s   10.35 (10.29) Peptide Signal:   %s   cut: 24 range:24-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRGYNLLFVLVTFLVLVAAVTAQGNRGSNNGGGRRPRFGFYGNRCRNVESIVKSVVESHVRSIPANAPGILRMHFHDCFVRGCDGSVLLAGNTSERTAVPNRSLRGFEVIEEAKARLEKACPRTVSCADILTLAARDAVVLTGGQRWEVPLGRLDGRISQASDVNLPGPSDSVAKQKQDFAAKTLNTLDLVTLVGGHTIGTAGCGLVRGRFFNFNGTGQPDPSIDSSFVPLIQAQCPQNGGTRVELDEGSVGRFDTSFLRKVTSSRVVLQSDLLLWRDPETRVIIERLLGLRRPSLRFGSEFGKSMVKMSLIEVKTRSADGEIRRVCSAIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 8, introns 2 and 3)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTCGTGGTTATAATTTGCTATTCGTTCTAGTCACGTTTTTAGTATTGGTTGCAGCTGTAACCGCACAAGGGAACCGTGGCTCAAACAACGGTGGTGGTCGAAGACCACGATTTGGG
TTTTATGGGAATAGATGCCGAAACGTAGAGTCTATTGTGAAATCTGTGGTTGAGTCTCATGTCCGGTCTATCCCGGCTAATGCACCTGGAATCTTGCGTATGCATTTCCACGATTGCTTT
GTCCGTGGCTGTGATGGCTCGGTTCTCCTCGCTGGTAACACCTCAGAGAGAACCGCAGTTCCAAACCGTTCACTGAGAGGTTTCGAAGTTATTGAAGAGGCTAAGGCTCGGCTTGAGAAG
GCTTGTCCTCGAACCGTTTCTTGTGCTGATATTCTCACCCTTGCTGCTCGAGACGCTGTCGTTTTG
GTAATATACTGAAATTATTACACGCACTATATCATAATTCGGTTTTTTATCCGT
GTCACATGATTAAAATATATAGCACTTATGGTCTCGTGTTTAACGGTAATTTAATTTAATATTGGTTTATGCAGACCGGTGGACAACGCTGGGAAGTGCCATTGGGACGTCTCGACGGCC
GAATCTCGCAAGCCTCAGACGTGAACTTGCCCGGACCAAGCGACTCAGTTGCTAAGCAGAAGCAAGACTTCGCTGCCAAAACTCTTAACACATTAGACCTCGTAACTCTTGTTG
GTACGT
TGTCATTGCATATGGTTTAAATGTAACACTTAAGAATTAATCAGAAAAATAATTAGCTCGTATATATACTATATATCCTACTAGCTAATTAATTACTAAGTGAGTTTTTTGGTTTTGACC
AGGCGGACACACAATAGGAACTGCTGGCTGCGGTCTAGTAAGGGGAAGGTTCTTTAACTTCAACGGCACAGGACAACCCGACCCATCAATCGACTCGAGTTTTGTGCCGCTGATTCAGGC
TCAGTGCCCTCAAAATGGAGGCACCCGAGTCGAGTTAGACGAGGGAAGTGTTGGTAGGTTTGACACATCGTTCCTAAGGAAGGTGACGTCAAGTCGCGTGGTTCTTCAATCCGATCTACT
CCTATGGAGGGATCCCGAGACCCGAGTCATCATTGAACGGTTATTAGGTTTACGCCGACCATCCTTGAGGTTCGGATCCGAGTTCGGGAAGTCGATGGTCAAGATGAGTCTCATAGAAGT
TAAGACTCGATCAGCTGATGGTGAGATTCGTAGGGTTTGCTCTGCGATCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTCGTGGTTATAATTTGCTATTCGTTCTAGTCACGTTTTTAGTATTGGTTGCAGCTGTAACCGCACAAGGGAACCGTGGCTCAAACAACGGTGGTGGTCGAAGACCACGATTTGGG
TTTTATGGGAATAGATGCCGAAACGTAGAGTCTATTGTGAAATCTGTGGTTGAGTCTCATGTCCGGTCTATCCCGGCTAATGCACCTGGAATCTTGCGTATGCATTTCCACGATTGCTTT
GTCCGTGGCTGTGATGGCTCGGTTCTCCTCGCTGGTAACACCTCAGAGAGAACCGCAGTTCCAAACCGTTCACTGAGAGGTTTCGAAGTTATTGAAGAGGCTAAGGCTCGGCTTGAGAAG
GCTTGTCCTCGAACCGTTTCTTGTGCTGATATTCTCACCCTTGCTGCTCGAGACGCTGTCGTTTTG
ACCGGTGGACAACGCTGGGAAGTGCCATTGGGACGTCTCGACGGCCGAATCTCG
CAAGCCTCAGACGTGAACTTGCCCGGACCAAGCGACTCAGTTGCTAAGCAGAAGCAAGACTTCGCTGCCAAAACTCTTAACACATTAGACCTCGTAACTCTTGTTG
GCGGACACACAATA
GGAACTGCTGGCTGCGGTCTAGTAAGGGGAAGGTTCTTTAACTTCAACGGCACAGGACAACCCGACCCATCAATCGACTCGAGTTTTGTGCCGCTGATTCAGGCTCAGTGCCCTCAAAAT
GGAGGCACCCGAGTCGAGTTAGACGAGGGAAGTGTTGGTAGGTTTGACACATCGTTCCTAAGGAAGGTGACGTCAAGTCGCGTGGTTCTTCAATCCGATCTACTCCTATGGAGGGATCCC
GAGACCCGAGTCATCATTGAACGGTTATTAGGTTTACGCCGACCATCCTTGAGGTTCGGATCCGAGTTCGGGAAGTCGATGGTCAAGATGAGTCTCATAGAAGTTAAGACTCGATCAGCT
GATGGTGAGATTCGTAGGGTTTGCTCTGCGATCAATTAA

Retrieve as FASTA