Entry information : AlyPrx72 (AL8G45140)
Entry ID 7551
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2017-04-06 (Christophe Dunand)
Peroxidase information: AlyPrx72 (AL8G45140)
Name (synonym) AlyPrx72 (AL8G45140)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx72
start..stop
S start..stop
AhalPrx01 688 0 1..336 1..336
AtPrx72 685 0 1..336 1..336
CrubPrx118 671 0 1..336 1..336
CagraPrx81 671 0 1..336 1..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 22770542..22770775 234 N° 2 22770861..22771052 192 N° 3 22771126..22771291 166 N° 4 22771393..22771811 419
join(22770542..22770775,22770861..22771052,22771126..22771291,22771393..22771811 )


exon

Literature and cross-references AlyPrx72 (AL8G45140)
DNA ref. Phytozome 12:   scaffold_8 (22770542..22771811)
Protein sequence: AlyPrx72 (AL8G45140)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (313)
PWM (Da):   %s   37215.87 (34795.6) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.82 (8.88) Peptide Signal:   %s   cut: 24 range:24-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKSLNILIAALSLIAFSPFCLCSKAYGSGGYLFPQFYDHSCPKAQEIVQSIVAKAFEHDPRMPASLLRLHFHDCFVKGCDASILLDSSGTIISEKRSNPNRNSARGFELIEEIKHALEQECPETVSCADILALAARDSTVITGGPSWEVPLGRRDSRGASLSGSNNDIPAPNNTFQTILTKFKRQGLDLVDLVSLSGSHTIGNSRCTSFRQRLYNQSGNGKPDLTLSQYYATLLRQRCPRSGGDQNLFFLDFATPFKFDNHYFKNLIMYKGLLSSDEILFTKNRESKELVKLYAENQGAFFEQFAKSMVKMGNISPLTGAKGEIRRICRRVNHAY

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 8, 3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGTCATTGAACATCCTTATTGCAGCTCTCTCTCTGATTGCATTTTCTCCTTTCTGTTTGTGTTCCAAAGCCTATGGAAGTGGCGGCTATCTCTTTCCTCAGTTCTACGACCAC
TCGTGTCCTAAAGCTCAAGAGATTGTTCAGTCCATTGTCGCTAAAGCATTCGAACATGATCCTCGCATGCCTGCCTCCTTGCTCAGACTCCATTTCCACGACTGTTTCGTCAAG
GTCTCA
AGCTCTGCAAAACTTTCTTAACGTTTAAAAACGTGCGGAAATTTCCAATCCTAATATATTTATCTCGTTGTGATACCAGGGATGTGATGCTTCCATACTATTGGACAGCAGTGGAACCAT
AATCAGCGAGAAACGATCAAACCCTAACCGAAACTCAGCCCGAGGTTTCGAACTCATCGAGGAAATCAAACATGCCTTAGAGCAAGAGTGTCCTGAAACAGTTTCTTGCGCTGATATCTT
GGCTCTTGCCGCTAGAGACTCAACTGTTATT
GTAAGTCATCACAATTCACTACACAAAATTAGTTGATTATACAGTATCAATAATTTGACAAATGAAATAACAGACGGGTGGACCGAGCT
GGGAAGTACCTCTAGGAAGGAGAGACTCGAGAGGAGCAAGTTTGAGTGGTTCCAACAATGACATTCCTGCTCCAAACAACACTTTTCAAACCATCCTCACAAAGTTCAAGCGTCAAGGCC
TTGATCTCGTCGATCTTGTCTCCCTCTCTG
GTATACATAACATTTGCAACAACTTATCTATCTTAGTAAACCAATTAATATATAAAAGCTCGTAATTTTAAGAAGCGTTTATATATATAT
ATGATTTTTAGGAAGTCACACCATTGGAAATTCAAGGTGCACAAGTTTCCGGCAGAGGTTATACAACCAGTCCGGCAACGGAAAGCCTGATCTGACTCTTAGCCAATACTATGCGACCTT
GTTGCGTCAACGATGTCCGAGATCCGGAGGTGACCAGAACCTCTTCTTCCTCGACTTCGCGACGCCGTTCAAGTTTGACAACCACTACTTCAAGAACCTGATCATGTACAAAGGTCTATT
GAGCTCTGATGAGATTTTGTTCACGAAGAACAGAGAGTCCAAGGAGCTGGTGAAGCTATACGCGGAGAATCAAGGGGCCTTCTTCGAGCAGTTTGCTAAATCGATGGTGAAGATGGGAAA
TATCTCTCCGTTGACGGGCGCCAAGGGAGAGATCCGGCGCATCTGTAGGAGGGTTAACCATGCCTATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGTCATTGAACATCCTTATTGCAGCTCTCTCTCTGATTGCATTTTCTCCTTTCTGTTTGTGTTCCAAAGCCTATGGAAGTGGCGGCTATCTCTTTCCTCAGTTCTACGACCAC
TCGTGTCCTAAAGCTCAAGAGATTGTTCAGTCCATTGTCGCTAAAGCATTCGAACATGATCCTCGCATGCCTGCCTCCTTGCTCAGACTCCATTTCCACGACTGTTTCGTCAAG
GGATGT
GATGCTTCCATACTATTGGACAGCAGTGGAACCATAATCAGCGAGAAACGATCAAACCCTAACCGAAACTCAGCCCGAGGTTTCGAACTCATCGAGGAAATCAAACATGCCTTAGAGCAA
GAGTGTCCTGAAACAGTTTCTTGCGCTGATATCTTGGCTCTTGCCGCTAGAGACTCAACTGTTATT
ACGGGTGGACCGAGCTGGGAAGTACCTCTAGGAAGGAGAGACTCGAGAGGAGCA
AGTTTGAGTGGTTCCAACAATGACATTCCTGCTCCAAACAACACTTTTCAAACCATCCTCACAAAGTTCAAGCGTCAAGGCCTTGATCTCGTCGATCTTGTCTCCCTCTCTG
GAAGTCAC
ACCATTGGAAATTCAAGGTGCACAAGTTTCCGGCAGAGGTTATACAACCAGTCCGGCAACGGAAAGCCTGATCTGACTCTTAGCCAATACTATGCGACCTTGTTGCGTCAACGATGTCCG
AGATCCGGAGGTGACCAGAACCTCTTCTTCCTCGACTTCGCGACGCCGTTCAAGTTTGACAACCACTACTTCAAGAACCTGATCATGTACAAAGGTCTATTGAGCTCTGATGAGATTTTG
TTCACGAAGAACAGAGAGTCCAAGGAGCTGGTGAAGCTATACGCGGAGAATCAAGGGGCCTTCTTCGAGCAGTTTGCTAAATCGATGGTGAAGATGGGAAATATCTCTCCGTTGACGGGC
GCCAAGGGAGAGATCCGGCGCATCTGTAGGAGGGTTAACCATGCCTATTAA

Retrieve as FASTA