Entry information : AlyPrx17 (481103)
Entry ID 7555
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-05-06 (Christophe Dunand)
Peroxidase information: AlyPrx17 (481103)
Name (synonym) AlyPrx17 (481103)
Class Class III peroxidase    [Orthogroup: Prx018]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx17
start..stop
S start..stop
AhalPrx10 665 0 1..329 1..329
AtPrx17 659 0 1..329 1..329
CrubPrx17-1A 607 0 1..329 1..332
CagraPrx31 607 0 1..329 1..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 938730..938933 204 N° 2 939023..939214 192 N° 3 939288..939881 594  
join(938730..938933,939023..939214,939288..939881)


exon

Literature and cross-references AlyPrx17 (481103)
DNA ref. Phytozome 11:   scaffold_4 (938730..939881)
Protein sequence: AlyPrx17 (481103)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (309)
PWM (Da):   %s   36677.44 (34494.2)  
PI (pH):   %s   5.15 (5.02) Peptide Signal:   %s   cut: 21 range:21-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLLPHLILYLTLFTVAVTGETLRPRFYRETCPEAESIVRKEMKKAMIKEARSVASVMRFQFHDCFVNGCDASLLLDDTPNMLGEKLSLSNIDSLRSFEVVDDIKEALEKACPATVSCADIVIMAARDAVALTGGPDWEVKLGRRDSLTASQKDSDDIMPSPRANATFLIDLFERFNLSVKDMVALSGSHSIGQGRCFSIMFRLYNQSGSGKPDPALEPSYRKKLDKLCPLGGDENVTGDLDATPQVFDNQYFKDLVSGRGFLNSDQTLYTNRVTREYVKMFSEDQGEFFRAFEEGMVKLGDLQSGRPGEIRFNCRVVNRRPIDVLLVS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, introns 1 and 2). No EST available.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AATATAAGAC GTTTTAGTTA AAAGTACGCC GATTATGAAG ATCTACTTTT TAAAAGTTCA GCCAATCATA AAAGAGACTG CATAATAAAA ATAATCATAA AATATTAATA ATATATAATT  TGCATAGAAA CTTGAAAACG ACTTATATTG TGAAACAAAA AATTTTATCC AAAACACCTT ATATTTTAAA ACTGAGAGAG TATATAATTA TGACTGTTTC TTCTCCGAAG TGTAATAAAT  TTTGCATATT ATAAAAAAAT TGAAAAATTG ACAACTAAAG ATGGGGACAA CATAATCTCT TAAAAACGGC AACGTATCAG TACCTTTTAG AGTTTCAGAA CGCAAGGTCA TGATGATGAC  GACTTTCTTA GTGTCAGTCA CTTTTAGAGT TTCAGATAAT TTCTTGTTTG GTTGCAAAAA AATATGAACC AATGGCTCAA AATTGTTGCC TCCCTTTGTC ACAACAGTTC TCTTATCTCA  AGACACCCAC TCACTATTAT ATTTTTTTTA CTAAAGTTTC ACTCTTTTAA TAAAACACAA AATTATCGTG TCAAAAACTT GTTTTTTTCT CGTTGATATT TGTTTTATTT TATATTTTCT  ACATTTTTTA TTTTGTATTA CAGATTGACG ATATAAAAAA AAACAAAGTT ATACTCCTAC TAGTTAACTT TTTTAAAATT ATATTGACCT TAGTAGATGT TGCCTTCATC ATGTTAGGTG  TGTTTCAAAC ACCTCTAACC ACAATTATTT CACTATTTTA CAGAGTTACA TATGGAGTAC TTATTTGGTT TATTGTGATA ATATTATCAA CAATTTGTTC AGAAAATTAA AATTATAAAA  AGGTAAATTA TTTTAATTTT TAGCTTTATC ATTAAATTAT CAGCCGTAGC GTAACTATAG CATTGATCAT CACAACCACA CTGATCACAC TAAACAATAA AAGATGCATG TTTTCTTTTT  GTAAATATAT ATAGTTTGAA TTATTTGGCC AACCCAACGC AAATGTGAAG ATAAGGTTTT GAATGCTTTT TACAAAGTCA AAAAGTGTCT TGACTCTACG TTAGGTTTAA CATCAAGGAG  TTGAATCATT CATTCAATTT CTTCATGACC TTTAAAAGTC TATCAATACA TGTGTGTTAC ATCATTCACT CAATTTCTTC ATGACCTTTA AAAGCCTATC AATACATGTG TGTTACACTA  TTTGATTATA AACATTGACC AGGATTAATG TTTGATTCTA GATCATTCGC ATTTCATAAA TACTTCTATT TTCCCCATTA TTGTCATCAA AAGTATTAAC TATAGCATTA TTGTCTTGAA  AACGTTACAT AAACATAATT GTTGTACAAA TATTTAACTA GTTGTTGAAT ACAATAACAA AAATCTAACT ATCCATAATA TAAAAAAATA ATTACTAGTA CTAGTTTTCA TCGAAACATA  AATGATGTTT TAACAATTTC AACGCATTTA AAAAGTTACA AAAAGAAAAT TGGCTCTTGA ATTTCGGTTT TTTGTACATT ATTTAATTTT CATTAGGATC AAACTAAATA TTTTCATGTT  AATATTTATA CATTTTAAGT CATCACTTAT TTTAAGTAAG AAAATAGATA AGACGATATT TATTTCCAAA CGGAAAGAGT ACTTATTAAT TCAAAAACAT ATTTGCAAAT ACGGATTTAT  GAATTTTATT AAACAATTAC CTGCAAAAGT TTCACACCTC TATAATTATC AAGTAATCCT TTTATCTTCT TTTTATTTGC CAGCTAATAT ACACCTAAAA AATTACCAAA TATTACTTCA  AACTCATTAT TAAATAGTTT CACAAGCCCA TATTTTTACC AAATACTACA TTTAATCCCC CATTGGGACC AATTCTATAA TTAGGAAATT TATTTATTTT CATTTATTAA ATCAATAAAT  AAAAAAGATA GAAATTGGAA AGCCCACCAC CACACTTGCA CAAATTCCAT CTATAAACAA CACAAAGCCT TTAGTATCAT TCTCGAAAAC CACCAAAAAC CTCTTTATTA ACCAACAAAC 
AAAGTCTCTT CTTCTTCTTC AATCACTGAA ACACAACACC AAAAAAGAAA AGAAAAAAGT 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCTTCTTCCCCATCTCATCCTCTACCTAACACTCTTCACGGTGGCTGTTACCGGAGAAACTCTCCGGCCAAGATTCTACAGAGAAACATGCCCTGAAGCTGAATCCATAGTAAGA
AAAGAAATGAAGAAAGCTATGATCAAAGAAGCAAGAAGCGTCGCTTCCGTCATGCGTTTCCAATTTCACGACTGTTTCGTCAAT
GTAATCACAATTGAATCTTTCTCTCTGTTCTTGATT
TTTTTTTACTCTGTTTTTTTTTCTCTGAATTTTCTTTGAATCATCAAATTCAGGGATGTGACGCATCTCTGTTGCTTGACGACACACCAAACATGCTTGGTGAGAAACTATCACTTTCCA
ACATCGATTCTTTAAGATCTTTCGAAGTCGTTGACGACATTAAAGAAGCTTTAGAGAAAGCTTGTCCTGCTACTGTTTCTTGTGCCGATATTGTTATCATGGCCGCTCGTGACGCCGTTG
CTCTT
GTAAGTCAATTTCAATTTTTTCCCGGTTTAATGATTGATTTCCGGTTTTGTAATTTTGGTTTTTGGAAACCAGACAGGAGGACCAGATTGGGAAGTGAAGCTAGGAAGGAGAGAT
AGTTTAACAGCGAGTCAAAAAGATTCCGATGATATAATGCCAAGTCCAAGAGCCAACGCAACTTTCTTGATTGATCTCTTCGAAAGATTCAATCTTTCTGTGAAAGACATGGTGGCTTTA
TCAGGGTCACACTCAATTGGTCAAGGTCGGTGTTTTTCAATCATGTTCAGGCTTTATAACCAATCCGGTTCTGGTAAACCGGATCCAGCTCTCGAACCGAGTTACCGTAAGAAGCTTGAC
AAGCTTTGTCCTTTGGGTGGAGACGAGAATGTGACTGGAGATCTAGATGCAACACCTCAGGTTTTTGATAATCAGTACTTTAAAGACTTGGTTTCAGGGAGAGGGTTTCTTAACTCTGAT
CAGACTTTGTACACGAATCGAGTGACGAGAGAGTATGTGAAGATGTTTAGTGAGGATCAAGGTGAGTTCTTTAGGGCTTTTGAAGAAGGGATGGTGAAGTTGGGTGATTTGCAATCTGGA
AGACCTGGTGAGATTAGGTTTAATTGTAGGGTTGTTAATAGAAGGCCTATTGATGTATTGCTTGTATCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCTTCTTCCCCATCTCATCCTCTACCTAACACTCTTCACGGTGGCTGTTACCGGAGAAACTCTCCGGCCAAGATTCTACAGAGAAACATGCCCTGAAGCTGAATCCATAGTAAGA
AAAGAAATGAAGAAAGCTATGATCAAAGAAGCAAGAAGCGTCGCTTCCGTCATGCGTTTCCAATTTCACGACTGTTTCGTCAAT
GGATGTGACGCATCTCTGTTGCTTGACGACACACCA
AACATGCTTGGTGAGAAACTATCACTTTCCAACATCGATTCTTTAAGATCTTTCGAAGTCGTTGACGACATTAAAGAAGCTTTAGAGAAAGCTTGTCCTGCTACTGTTTCTTGTGCCGAT
ATTGTTATCATGGCCGCTCGTGACGCCGTTGCTCTT
ACAGGAGGACCAGATTGGGAAGTGAAGCTAGGAAGGAGAGATAGTTTAACAGCGAGTCAAAAAGATTCCGATGATATAATGCCA
AGTCCAAGAGCCAACGCAACTTTCTTGATTGATCTCTTCGAAAGATTCAATCTTTCTGTGAAAGACATGGTGGCTTTATCAGGGTCACACTCAATTGGTCAAGGTCGGTGTTTTTCAATC
ATGTTCAGGCTTTATAACCAATCCGGTTCTGGTAAACCGGATCCAGCTCTCGAACCGAGTTACCGTAAGAAGCTTGACAAGCTTTGTCCTTTGGGTGGAGACGAGAATGTGACTGGAGAT
CTAGATGCAACACCTCAGGTTTTTGATAATCAGTACTTTAAAGACTTGGTTTCAGGGAGAGGGTTTCTTAACTCTGATCAGACTTTGTACACGAATCGAGTGACGAGAGAGTATGTGAAG
ATGTTTAGTGAGGATCAAGGTGAGTTCTTTAGGGCTTTTGAAGAAGGGATGGTGAAGTTGGGTGATTTGCAATCTGGAAGACCTGGTGAGATTAGGTTTAATTGTAGGGTTGTTAATAGA
AGGCCTATTGATGTATTGCTTGTATCTTGA

Retrieve as FASTA