Entry information : AlyPrx43
Entry ID 7556
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx43
Name AlyPrx43
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx43
start..stop
S start..stop
AtPrx43 647 0 1..326 1..326
AhalPrx42 621 0 1..326 45..370
CagraPrx52 619 0 1..326 1..326
BstrPrx30 614 0 1..326 1..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6870863..6871075 213 N° 2 6870607..6870789 183 N° 3 6870365..6870527 163 N° 4 6869004..6869425 422
complement(join(6869004..6869425,6870365..6870527,6870607..6870789,6870863..6871 075))


exon

Literature and cross-references AlyPrx43
DNA ref. Phytozome 12:   scaffold_7 (6871075..6869004)
Protein sequence: AlyPrx43
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (302)
PWM (Da):   %s   35342.17 (32700.6)  
PI (pH):   %s   5.71 (5.04) Peptide Signal:   %s   cut: 25 range:25-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVWAKARMRLALSLITVFLGISLADLEVGFYSNTCPQAESIVRRVVLGAALSDPNLPAILLRLHFHDCFVEGCDGSILVNNGAISEKNAFGHEGVRGFEIVEAAKAELEAACPGVVSCSDIVALAARDAISLANGPAYEVPTGRRDGRVSDMSLAKDMPEVSDSIQILKDKFMQKGLNAKDLVLLSAAHTIGTTACFFMSKRLYDFLPGGQPDPTINPTFLPELTTQCPQNGDINVRLPIDRFSERLFDKQILHNIKDGFAVLQTDAGLYEDVITRQVVDSYLGMLNPFFGPTFESDFVKAIVKMGKIGVKTGFKGEIRRVCSAFN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, 3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGTGGGCAAAGGCTAGGATGAGACTAGCTTTGTCTCTTATTACGGTTTTCCTCGGCATCTCTCTTGCTGATCTTGAAGTTGGATTTTACTCCAATACATGTCCTCAAGCCGAGTCA
ATCGTTAGGAGAGTTGTCTTGGGAGCTGCTCTTTCCGACCCTAACCTCCCAGCCATACTTCTACGGCTCCATTTCCATGATTGCTTTGTTGAG
GTACAATGCACTTCCTCCTCTTTGTGC
TTTCTACTATTGCTTGCTATTCTTAGAGATTTAACCACACGTTCAGGGATGTGATGGCTCGATCCTCGTGAACAACGGAGCAATCTCTGAAAAGAATGCATTTGGGCATGAAGGCGTTAG
AGGATTTGAGATTGTAGAAGCTGCCAAAGCCGAGCTTGAAGCTGCATGCCCCGGTGTTGTCTCCTGCTCAGACATTGTTGCCTTGGCTGCACGTGATGCCATATCTTTG
GTAAAGAGTAA
ATTAGAGAGAAAAAAACCTTTCGATCTTTATCTATCTTCTTCTCCGTTGTGATCAATTCATGATACAGGCAAATGGACCGGCATATGAGGTGCCAACTGGGCGGAGAGATGGTCGGGTGT
CGGACATGTCATTGGCTAAGGACATGCCGGAGGTGAGTGACTCGATTCAGATACTAAAGGATAAGTTTATGCAGAAGGGACTCAACGCCAAAGACCTCGTGCTTCTCAGTG
GTATGCATC
TCTTCTTCTGTTTTTTTTCTCTCTCATTCATGTTTGTTTGGTGGTTTCGAATCTCTCAAAGTTTTTGGTTCGAAGTTCAAGTTATATGATTTTCATTTCCCGGATCCGTGATGTGTTTCG
CATGTTTCGTCCGTTACCTCTCTTCTTCGTGTGTTAAGTGTCACGTGCGTTACGAAACTCCGGTAGACCAATAGAAAACATTATAGGAAATTTTTCCAGCTAAGCCAGCAGTGTTTTTTG
CGCAGAAAAAGGTTTTCGTGAAAAATTGAATGTTAAATTTGTGAAAATTTTCTTCTAACCAAAAAAAAAAAAAATAGTCAGATTTACTAGTTAGCTAAATTTTAAGAGAAATGAAAAGTC
GTTTGTAAAAAAAAAATTTAGGCTTTTTTGGTCAACTTACTATATGCACTTATTCAAGAATTTGGTATTTTAGTTCTAATAGACTAATACTAAATTGAGTGTGTTATAGTAGCAACAAGT
GTTTTGATGTTCTGTCATCTTAACCACTTAATCTGGCATGGTCCAGAAATGTTAATTCACCCCGAAAATAGGCCTGTTATACGTTCGGCAGTAAATCTCACAAAACATCATAAATATCTA
CCGGCCCATTCTTTAGACTAGATTTCAGGGTGAAATTATCAACTTGCACGTGTGACCAAACAAAGAAGAAAGTAAGAAAATTATCAACTTGCACGTGTGACCAAACAAAGAAGAAAGTAA
GAAACCATCAACATGCACGAGTCTAATACAGTAGTGATCATGCGTTTTAAACCTGGTCAGGCTCAGTTTTTGTCATTTTACATAATTAAATTTCAAGTTCACATGTTTCAATATGAGAAA
ACTTTGTCAAAAACAAAATAAAAAAATTATTTGTTTCTAGCTTTAAGAAATCAAAAGATCTTAACTTGAGTGGTCTACTTTCTGTATCAGCTGCTCACACTATCGGAACAACGGCCTGCT
TCTTCATGTCCAAACGTCTCTACGATTTCTTACCCGGTGGTCAACCTGACCCGACTATCAATCCGACATTCCTACCCGAATTAACCACTCAGTGCCCACAAAATGGTGACATAAACGTCC
GGTTACCAATTGACCGGTTCAGTGAACGGCTATTCGACAAGCAGATTCTGCACAACATAAAGGATGGTTTCGCTGTGCTTCAGACCGACGCAGGTCTTTACGAGGATGTTATAACTCGAC
AGGTCGTGGATTCCTATCTTGGGATGCTAAATCCATTCTTTGGGCCAACGTTTGAGTCCGATTTCGTAAAGGCAATAGTAAAGATGGGGAAGATTGGTGTGAAGACTGGTTTCAAGGGGG
AAATTCGACGGGTTTGCTCGGCCTTCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGTGGGCAAAGGCTAGGATGAGACTAGCTTTGTCTCTTATTACGGTTTTCCTCGGCATCTCTCTTGCTGATCTTGAAGTTGGATTTTACTCCAATACATGTCCTCAAGCCGAGTCA
ATCGTTAGGAGAGTTGTCTTGGGAGCTGCTCTTTCCGACCCTAACCTCCCAGCCATACTTCTACGGCTCCATTTCCATGATTGCTTTGTTGAG
GGATGTGATGGCTCGATCCTCGTGAAC
AACGGAGCAATCTCTGAAAAGAATGCATTTGGGCATGAAGGCGTTAGAGGATTTGAGATTGTAGAAGCTGCCAAAGCCGAGCTTGAAGCTGCATGCCCCGGTGTTGTCTCCTGCTCAGAC
ATTGTTGCCTTGGCTGCACGTGATGCCATATCTTTG
GCAAATGGACCGGCATATGAGGTGCCAACTGGGCGGAGAGATGGTCGGGTGTCGGACATGTCATTGGCTAAGGACATGCCGGAG
GTGAGTGACTCGATTCAGATACTAAAGGATAAGTTTATGCAGAAGGGACTCAACGCCAAAGACCTCGTGCTTCTCAGTG
CTGCTCACACTATCGGAACAACGGCCTGCTTCTTCATGTCC
AAACGTCTCTACGATTTCTTACCCGGTGGTCAACCTGACCCGACTATCAATCCGACATTCCTACCCGAATTAACCACTCAGTGCCCACAAAATGGTGACATAAACGTCCGGTTACCAATT
GACCGGTTCAGTGAACGGCTATTCGACAAGCAGATTCTGCACAACATAAAGGATGGTTTCGCTGTGCTTCAGACCGACGCAGGTCTTTACGAGGATGTTATAACTCGACAGGTCGTGGAT
TCCTATCTTGGGATGCTAAATCCATTCTTTGGGCCAACGTTTGAGTCCGATTTCGTAAAGGCAATAGTAAAGATGGGGAAGATTGGTGTGAAGACTGGTTTCAAGGGGGAAATTCGACGG
GTTTGCTCGGCCTTCAATTGA

Retrieve as FASTA