Entry information : AlyPrx25
Entry ID 7559
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-12 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx25
Name AlyPrx25
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx25
start..stop
S start..stop
BstrPrx81 649 0 1..326 1..326
AtPrx25 647 0 1..326 14..341
CrubPrx110 635 0 1..326 1..330
CagraPrx44 632 0 1..326 1..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 20220722..20220937 216 N° 2 20220456..20220635 180 N° 3 20220190..20220352 163 N° 4 20219328..20219749 422
complement(join(20219328..20219749,20220190..20220352,20220456..20220635,2022072 2..20220937))


exon

Literature and cross-references AlyPrx25
DNA ref. Phytozome 11:   scaffold_4 (20220937..20219328)
Protein sequence: AlyPrx25
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326
PWM (Da):   %s   35636.19  
PI (pH):   %s   6.98
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGVYVGKYCYVMIIVLVLGNEVRSQLLKNGYYSTSCPKAESIVRSTVESHFDSDPTISPGLLRLHFHDCFVQGCDGSVLIKGKSAEQAALPNLGLRGFEVIDDAKARLELECPGVVSCADILALAARDSVDLSDGPSWRVPTGRKDGKISLAKEASNLPSPLDSVAVQKQKFQDKGLDTHDLVTLLGAHTIGQTDCLFFRYRLYNFTVTGNSDPTISPPFLTQLKTLCPPNGDGSKRVALDIGSPSKFDESFFKNLRDGNAILESDQRLWSDAETNEVVKKYASRLRGLLGFRFDYEFGKAMIKMSSIDVKTDVDGEVRKVCSKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGTGTACGTAGGAAAGTATTGTTATGTAATGATAATAGTGTTGGTGTTGGGAAACGAAGTGAGAAGCCAATTGTTAAAAAATGGTTATTATTCAACTTCATGTCCAAAAGCTGAG
TCGATAGTAAGATCCACTGTTGAATCTCACTTTGATTCTGATCCCACAATTTCCCCTGGCTTGCTTCGGCTTCATTTCCATGACTGTTTTGTTCAG
GTTCCAACTACTTTCTTCTTATTT
TTAATCTCAATCTTTTATCAATTATACAAGTTAATTGATTGTTGAATATAACCTATTATTAGGGTTGTGATGGTTCGGTTTTAATCAAAGGGAAATCTGCGGAGCAAGCTGCTCTACCGA
ATCTTGGTCTAAGAGGGTTCGAAGTGATCGACGATGCGAAAGCCCGGCTCGAGTTGGAGTGTCCAGGAGTTGTGTCATGTGCAGATATACTTGCACTTGCAGCTCGTGATTCTGTTGACT
TG
GTACGCAAGATTACTAAACCTAATTAGGGTACTTAATTCCTTTAATTTGGTAGATTTTAATTACTGATATGAGCTGAGTTACGTATTTTTGTATGAAAATAAGAGTGATGGGCCAAGC
TGGCGAGTACCAACGGGTCGCAAAGACGGGAAAATCTCGTTGGCAAAAGAAGCATCGAATCTACCTTCTCCACTTGACTCTGTTGCTGTTCAAAAGCAAAAGTTTCAAGATAAAGGATTG
GATACTCATGATCTCGTTACTCTACTCG
GTATGTCTAATAATTCGTCTATCTCTTTTTCTATTATTTAAGAACTTTTAAGGAAGATTATTTTCTAATTTCTTGTTGAGTTTGTCTATTTG
TTTATATTAAAACTCTATCCATATGTTCAAAGAAACATAAGTATTAGTGAGATCTTCAAAGTTGCAACTAAGCCATATGCTGCTGCACACATCACATGCCAACATGAAAAACGTGGAAGT
GACTAAAAGTTGGAGTGAACCTTCTTTCATTTTATTGATATTTTAGCAAAAACTTTTAGTTTATTAGTCGTTGATTTGAGGAAAATCAAAATGGAAACAACACCTTTTTTCGTCGTCTTA
CTCAAAATAGACCAAGAAAATTTGCGACAATCTTTTTCATAAGGAAAAATTGGATACATCCTTGGAACAATAACGCATCTAAAAGAGTTATAATTTTCTTGAGGACAGGTGCACATACGA
TAGGCCAAACGGACTGTCTCTTCTTCCGTTACCGTCTATACAACTTCACGGTGACCGGAAACTCCGATCCAACCATAAGTCCACCGTTTCTTACACAGCTCAAGACTCTCTGTCCTCCCA
ATGGAGACGGTTCCAAACGTGTTGCTCTTGACATTGGTAGTCCCTCAAAATTCGATGAAAGTTTCTTCAAGAACTTACGCGATGGCAACGCTATTCTAGAGTCGGACCAACGGCTTTGGT
CAGACGCCGAGACAAATGAAGTGGTGAAGAAGTATGCGAGTCGTCTTAGAGGTTTGTTAGGGTTTAGGTTTGATTATGAGTTTGGTAAAGCTATGATTAAGATGAGCTCCATTGATGTAA
AGACTGACGTTGATGGTGAGGTTAGAAAAGTTTGTTCCAAGGTGAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAGTGTACGTAGGAAAGTATTGTTATGTAATGATAATAGTGTTGGTGTTGGGAAACGAAGTGAGAAGCCAATTGTTAAAAAATGGTTATTATTCAACTTCATGTCCAAAAGCTGAG
TCGATAGTAAGATCCACTGTTGAATCTCACTTTGATTCTGATCCCACAATTTCCCCTGGCTTGCTTCGGCTTCATTTCCATGACTGTTTTGTTCAG
GGTTGTGATGGTTCGGTTTTAATC
AAAGGGAAATCTGCGGAGCAAGCTGCTCTACCGAATCTTGGTCTAAGAGGGTTCGAAGTGATCGACGATGCGAAAGCCCGGCTCGAGTTGGAGTGTCCAGGAGTTGTGTCATGTGCAGAT
ATACTTGCACTTGCAGCTCGTGATTCTGTTGACTTG
AGTGATGGGCCAAGCTGGCGAGTACCAACGGGTCGCAAAGACGGGAAAATCTCGTTGGCAAAAGAAGCATCGAATCTACCTTCT
CCACTTGACTCTGTTGCTGTTCAAAAGCAAAAGTTTCAAGATAAAGGATTGGATACTCATGATCTCGTTACTCTACTCG
GTGCACATACGATAGGCCAAACGGACTGTCTCTTCTTCCGT
TACCGTCTATACAACTTCACGGTGACCGGAAACTCCGATCCAACCATAAGTCCACCGTTTCTTACACAGCTCAAGACTCTCTGTCCTCCCAATGGAGACGGTTCCAAACGTGTTGCTCTT
GACATTGGTAGTCCCTCAAAATTCGATGAAAGTTTCTTCAAGAACTTACGCGATGGCAACGCTATTCTAGAGTCGGACCAACGGCTTTGGTCAGACGCCGAGACAAATGAAGTGGTGAAG
AAGTATGCGAGTCGTCTTAGAGGTTTGTTAGGGTTTAGGTTTGATTATGAGTTTGGTAAAGCTATGATTAAGATGAGCTCCATTGATGTAAAGACTGACGTTGATGGTGAGGTTAGAAAA
GTTTGTTCCAAGGTGAACTAG

Retrieve as FASTA