Entry information : ZmPrx60
Entry ID 756
Creation 2005-12-05 (Christophe Dunand)
Last sequence changes 2005-12-05
Sequence status complete
Reviewer reviewer name not stored
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmPrx60
Name ZmPrx60
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Mixed tissues
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx60
start..stop
S start..stop
SbPrx30 569 0 3..336 4..332
OsPrx98 487 6e-175 27..335 24..329
SiPrx125 477 6e-171 29..335 23..327
ZmPrx125 469 5e-168 29..336 17..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 235919127..235919366 240 N° 2 235919469..235919669 201 N° 3 235919756..235919921 166 N° 4 235920029..235920432 404
join(235919127..235919366,235919469..235919669,235919756..235919921,235920029..2 35920432)


exon

Literature and cross-references ZmPrx60
Literature Walbot,V., unpublished
Protein ref. UniProtKB:   B4FZR9   B4FJ11 [3' end]
DNA ref. GenBank:   AC211016.3 (57556..58858)
mRNA ref. GenBank:   BT042607
Protein sequence: ZmPrx60
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (310)
PWM (Da):   %s   34868.65 (32352.3)  
PI (pH):   %s   8.33 (8.15) Peptide Signal:   %s   cut: 30 range:27-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGGGGGVHRRAAALLFVVVLAAVDQAGKSVCEAQLRRGYYAGVCPDVESIVRGVVARKVQQTAATVGATVRLFFHDCFVEGCDASVMVASTANNTAEKDHVINQSLAGDGFDTVIRARAAVDAVPGCRGKVSCADVLAMATRDAIALAGGPSYAVELGRLDGLRSTASSVNGRLPAPFFNLDQLSQMFAANGLSQADMIALSAGHTVGLAHCGTFSGRLRGPSAPDRTLDSGYAAQLAAWCPAGVDPRVAVAMDPVTPVAFDNQFFRNLQAGKGLLASDQVLHADPRSRPTVDALAQSSVAFERAFVEAMTKMGRVGVKTARDRQGNVRRDCAVLG

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 3 introns) and 26 ESTs. Cultivar="B73".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGGCGGCGGCGGCGTGCATCGGCGAGCGGCGGCGCTGCTCTTCGTGGTGGTGCTAGCCGCGGTGGATCAGGCCGGCAAAAGCGTCTGCGAGGCGCAGCTCCGGCGCGGGTACTAC
GCCGGCGTGTGCCCCGACGTGGAGTCCATCGTCCGCGGCGTGGTGGCCAGGAAGGTCCAGCAGACGGCAGCCACAGTCGGCGCCACCGTGCGCCTCTTCTTCCACGACTGCTTCGTCGAG
GTAAATATATTATATATACCGACGTAACGACCGGGCATGCATCATGCATCCGGCAGCCGGCCGTGACATGCATACGTCGACGACCTGTACGTACGTACGTAGGGCTGCGACGCGTCGGTG
ATGGTGGCGTCGACGGCGAACAACACGGCGGAGAAGGACCACGTCATCAACCAGTCCCTGGCCGGCGATGGCTTCGACACGGTGATCAGAGCCAGGGCGGCCGTGGACGCCGTGCCGGGG
TGCCGCGGCAAGGTGTCCTGCGCCGACGTGCTCGCCATGGCCACCAGGGACGCCATCGCGCTG
GTACACGAACACCGCCTGCAGTGCAGTACTTAATTACTATAGCAAGCGAATTACTAG
AATATTGGAAGGTGAACGAATGCGCGCAGGCCGGCGGGCCGTCGTACGCTGTGGAGCTTGGTCGGCTGGACGGGCTGAGGTCGACGGCCAGCAGCGTCAACGGGAGGCTGCCGGCGCCCT
TCTTCAACCTGGACCAGCTGAGCCAGATGTTCGCCGCCAACGGGCTGTCGCAGGCCGACATGATCGCCCTCTCAG
GTGCATGCATTGCATGGCCGGCCATCAATCGAGTATACTAGCTAG
CTATTAGGCTGGAGCCGGATCGGACTGACGACGAACGACCACTGCTGGTCCACTGCATGCAGCCGGGCACACGGTGGGGCTGGCACACTGCGGCACGTTCTCGGGACGTCTGCGGGGGCC
GTCGGCGCCGGACCGGACGCTGGACTCGGGGTACGCGGCGCAGCTTGCGGCGTGGTGCCCGGCCGGGGTGGACCCGCGGGTGGCCGTGGCCATGGACCCCGTGACGCCCGTCGCCTTCGA
CAACCAGTTCTTCCGCAACCTGCAGGCCGGGAAGGGCCTTCTGGCGTCGGACCAGGTGCTGCACGCGGACCCTAGGTCCAGGCCCACCGTCGACGCGCTGGCCCAGAGCAGCGTGGCGTT
CGAGCGGGCCTTCGTGGAGGCCATGACGAAGATGGGCCGCGTCGGCGTCAAGACGGCCCGGGACCGGCAGGGCAACGTCCGCCGCGACTGTGCCGTGCTCGGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGGCGGCGGCGGCGTGCATCGGCGAGCGGCGGCGCTGCTCTTCGTGGTGGTGCTAGCCGCGGTGGATCAGGCCGGCAAAAGCGTCTGCGAGGCGCAGCTCCGGCGCGGGTACTAC
GCCGGCGTGTGCCCCGACGTGGAGTCCATCGTCCGCGGCGTGGTGGCCAGGAAGGTCCAGCAGACGGCAGCCACAGTCGGCGCCACCGTGCGCCTCTTCTTCCACGACTGCTTCGTCGAG
GGCTGCGACGCGTCGGTGATGGTGGCGTCGACGGCGAACAACACGGCGGAGAAGGACCACGTCATCAACCAGTCCCTGGCCGGCGATGGCTTCGACACGGTGATCAGAGCCAGGGCGGCC
GTGGACGCCGTGCCGGGGTGCCGCGGCAAGGTGTCCTGCGCCGACGTGCTCGCCATGGCCACCAGGGACGCCATCGCGCTG
GCCGGCGGGCCGTCGTACGCTGTGGAGCTTGGTCGGCTG
GACGGGCTGAGGTCGACGGCCAGCAGCGTCAACGGGAGGCTGCCGGCGCCCTTCTTCAACCTGGACCAGCTGAGCCAGATGTTCGCCGCCAACGGGCTGTCGCAGGCCGACATGATCGCC
CTCTCAG
CCGGGCACACGGTGGGGCTGGCACACTGCGGCACGTTCTCGGGACGTCTGCGGGGGCCGTCGGCGCCGGACCGGACGCTGGACTCGGGGTACGCGGCGCAGCTTGCGGCGTGG
TGCCCGGCCGGGGTGGACCCGCGGGTGGCCGTGGCCATGGACCCCGTGACGCCCGTCGCCTTCGACAACCAGTTCTTCCGCAACCTGCAGGCCGGGAAGGGCCTTCTGGCGTCGGACCAG
GTGCTGCACGCGGACCCTAGGTCCAGGCCCACCGTCGACGCGCTGGCCCAGAGCAGCGTGGCGTTCGAGCGGGCCTTCGTGGAGGCCATGACGAAGATGGGCCGCGTCGGCGTCAAGACG
GCCCGGGACCGGCAGGGCAACGTCCGCCGCGACTGTGCCGTGCTCGGCTGA

Retrieve as FASTA