Entry information : AlyPrx61
Entry ID 7560
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2012-06-14 (Catherine Mathe)
Peroxidase information: AlyPrx61
Name AlyPrx61
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx61
start..stop
S start..stop
AtPrx61 685 0 3..341 2..340
BstrPrx68 681 0 1..341 1..341
TsPrx61 656 0 1..341 1..341
BrPrx61-1Aa_other 652 0 1..341 1..341
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10350648..10350896 249 N° 2 10350381..10350560 180 N° 3 10350121..10350280 160 N° 4 10349127..10349563 437
complement(join(10349127..10349563,10350121..10350280,10350381..10350560,1035064 8..10350896))


exon

Literature and cross-references AlyPrx61
DNA ref. JGI gene:   489264 Phytozome 12:   scaffold_6 (10350896..10349127)
mRNA ref. JGI transcript:   489264
Protein sequence: AlyPrx61
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   341 (315)
PWM (Da):   %s   37477.88 (34647.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.18 (7.97) Peptide Signal:   %s   cut: 27 range:27-341
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRQFVKFFPLLAIVIISLAGTATIEAATGLNPPVKLVWHYYKVTNTCDDAETYIRYQVEKFYKNDSSIAPKLLRLLYSDCMVNGCDASVLLQGPNSERTAPQNRGLGGFVIIDKIKQVLESRCPGVVSCADILNLATRDAVHMAGAPSYPVFTGRRDGGRLNADAVDLPSPSISVDESLAYFKSKGLDVLDMTTLLGAHSMGKTHCSYIVDRLYNFKNTGKPDPTMNSTLVSQLRYLCPPRTQKGQTDPLVYLNPDSGSSNRFTSSYYSRVLSHNAVLRVDQELLNNDDSKEITQEFASGFEDFRKSFALAMSRMGSINVLTGTAGEIRRDCRVTNANYGA

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 3 introns). Problabe saequencing error: AGGCAGTTT instead of ATGCAGTTT. Containing motif 'YSDC'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCAGTTTGTGAAATTTTTCCCACTACTGGCCATCGTAATCATAAGCTTAGCCGGAACGGCGACGATAGAGGCTGCGACGGGATTGAACCCTCCGGTGAAGCTGGTTTGGCATTAT
TACAAAGTTACTAACACTTGTGATGATGCAGAAACTTATATTAGATACCAAGTTGAAAAGTTTTATAAGAATGATAGTAGCATTGCCCCAAAGCTTCTTCGTCTCCTCTACTCCGATTGT
ATGGTTAAT
GTAAGTGAAAACAACTAGAACAGTATATACCTTCATTCTTTTTATGACCGATTGTATGTTGTTGATTTATGTAAAATGTGTATGTAGGGATGTGATGCTTCGGTTCTTTTG
CAAGGACCAAACTCGGAGAGGACAGCTCCACAGAATCGAGGGCTTGGAGGTTTTGTGATAATCGATAAAATAAAGCAAGTTCTTGAATCACGCTGTCCTGGTGTTGTTTCTTGCGCTGAT
ATCCTCAACCTTGCCACTAGAGATGCTGTTCACATG
GTACATACTTGCATGTTCTTATTAACGTAGATGTATCGATCGATTTTTTGAATTTTATTGAATGGTGTTGTTTTGACGAATTCG
ATGAAATGATGAATAGGCCGGTGCACCGTCTTATCCTGTGTTTACCGGGAGAAGGGATGGAGGGAGATTAAATGCAGACGCCGTAGATCTGCCATCACCGTCCATCTCAGTCGATGAGTC
ATTGGCATACTTCAAGTCCAAAGGTCTTGACGTTTTGGATATGACTACTCTTCTAG
GTATCTCATAGTCTTCTCTTCTTCTTCTTTTTTTCTTTTTTTATTTCCTTTAGAGACAAGCATC
TTTTTTATCAGTTCTTCAAGGGAAACGTAATCCCAATGCTATTACTAAAACTTGATTTGTTTGTTTACGTTTATGTTTATATTACTAAAATAACTTTTTGAAAAATCAATCCACATACGT
ATTTTAATCAAAATCATTTAGAAGTTATAAAAGTATACATCAAATGAACTGTTACCGTCACTTTTTGGCCGCTGCGTTGGAATTTGCAAAAATATTTTATGAAAATCTGAAAATGTTTAA
TATTTCTATAAGAAAAAAAAAATGAGATTGTAATTTAAGGGTCTAGTAGCTTTGTTTAGTTACTATAAACAATTAATTCTCATTATATGCAAAACTTAAATACTACTATAAAGTTTACAA
GACAGTTTCACATCCTAGAAGATTATCCACTAGTAATCCAGAAAGAAAGATATAGTAATATACTTAATTAAAGTGGAGCTAAATAAGTACTATTGGGTGAATATCAACAAGCTCTAACTG
TGTAATGAAACAGGAGCACATTCAATGGGGAAGACACATTGCAGCTACATAGTGGACAGACTATACAACTTCAAGAACACTGGGAAACCAGATCCGACCATGAACTCAACATTGGTTTCA
CAACTTCGATATCTTTGTCCTCCAAGAACACAAAAGGGACAAACGGACCCACTCGTTTACCTAAACCCAGACTCAGGCTCGAGCAACAGATTCACCAGCTCCTACTACTCTCGTGTCTTG
TCTCACAACGCTGTTTTGAGGGTGGACCAAGAGTTGCTCAACAACGATGACTCAAAGGAGATCACGCAAGAGTTCGCTTCGGGTTTTGAAGATTTCAGAAAGTCATTTGCTTTGGCAATG
TCGAGGATGGGATCTATCAATGTTTTGACGGGAACAGCTGGAGAGATTCGGCGAGACTGCAGAGTTACCAACGCTAATTACGGGGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCAGTTTGTGAAATTTTTCCCACTACTGGCCATCGTAATCATAAGCTTAGCCGGAACGGCGACGATAGAGGCTGCGACGGGATTGAACCCTCCGGTGAAGCTGGTTTGGCATTAT
TACAAAGTTACTAACACTTGTGATGATGCAGAAACTTATATTAGATACCAAGTTGAAAAGTTTTATAAGAATGATAGTAGCATTGCCCCAAAGCTTCTTCGTCTCCTCTACTCCGATTGT
ATGGTTAAT
GGATGTGATGCTTCGGTTCTTTTGCAAGGACCAAACTCGGAGAGGACAGCTCCACAGAATCGAGGGCTTGGAGGTTTTGTGATAATCGATAAAATAAAGCAAGTTCTTGAA
TCACGCTGTCCTGGTGTTGTTTCTTGCGCTGATATCCTCAACCTTGCCACTAGAGATGCTGTTCACATG
GCCGGTGCACCGTCTTATCCTGTGTTTACCGGGAGAAGGGATGGAGGGAGA
TTAAATGCAGACGCCGTAGATCTGCCATCACCGTCCATCTCAGTCGATGAGTCATTGGCATACTTCAAGTCCAAAGGTCTTGACGTTTTGGATATGACTACTCTTCTAG
GAGCACATTCA
ATGGGGAAGACACATTGCAGCTACATAGTGGACAGACTATACAACTTCAAGAACACTGGGAAACCAGATCCGACCATGAACTCAACATTGGTTTCACAACTTCGATATCTTTGTCCTCCA
AGAACACAAAAGGGACAAACGGACCCACTCGTTTACCTAAACCCAGACTCAGGCTCGAGCAACAGATTCACCAGCTCCTACTACTCTCGTGTCTTGTCTCACAACGCTGTTTTGAGGGTG
GACCAAGAGTTGCTCAACAACGATGACTCAAAGGAGATCACGCAAGAGTTCGCTTCGGGTTTTGAAGATTTCAGAAAGTCATTTGCTTTGGCAATGTCGAGGATGGGATCTATCAATGTT
TTGACGGGAACAGCTGGAGAGATTCGGCGAGACTGCAGAGTTACCAACGCTAATTACGGGGCTTAA

Retrieve as FASTA