Entry information : AlyPrx04
Entry ID 7561
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx04
Name AlyPrx04
Class Class III peroxidase    [Orthogroup: Prx012]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx04
start..stop
S start..stop
AtPrx04 617 0 1..316 1..315
AhalPrx45 615 0 1..316 1..323
BstrPrx77 610 0 1..316 1..316
CagraPrx58 602 0 1..316 1..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6141319..6141516 198 N° 2 6141026..6141217 192 N° 3 6140647..6140815 169 N° 4 6140166..6140557 392
complement(join(6140166..6140557,6140647..6140815,6141026..6141217,6141319..6141 516))


exon

Literature and cross-references AlyPrx04
DNA ref. Phytozome 12:   scaffold_1 (6141516..6140166)
Protein sequence: AlyPrx04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (297)
PWM (Da):   %s   34201.07 (32106.9)  
PI (pH):   %s   7.87 (7.68) Peptide Signal:   %s   cut: 20 range:20-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAIFKILVLLLSLSCFCQAQLSPSFYDQTCPNALSTIRSSIRTAISRERRMAASLIRLHFHDCFVNGCDASVMLVATPTMESERDSLANFQSARGFEVIDQAKSAVESVCPGVVSCADIIAVAARDASEYVGGPRYNVKVGRRDSTNAFRAIADSGDLPNFRASLNDLSELFLKKGLNTRDLVALSGAHTLGQSQCLTFKGRLYDNSSDIDAGFSSTRKRRCPVNGGDTTLAPLDQVTPNSFDNNYYRNLMQKKGLLETDQVLFGTGASTDSIVTEYSRNPSRFASDFGAAMIKMGDIQTLIGSDGQIRRICSAVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATCTTCAAGATTCTTGTATTGTTGTTGAGTTTGTCTTGTTTCTGTCAAGCACAACTTTCTCCTTCTTTCTACGACCAAACTTGTCCAAATGCTCTCTCGACCATCCGGTCTTCA
ATCCGAACCGCAATCAGCCGTGAACGTAGAATGGCTGCTTCTCTCATCCGTCTCCATTTCCACGACTGCTTCGTTAAT
GTATGTAATTAACATTTGATCCAATATGCATGAGTGTTTATA
TTATACATATTGTTTCATGGACCGCTCTAAAATTATGTTTGGTTTTGATTTTTTTGTAGGGTTGTGATGCATCGGTCATGCTCGTGGCAACTCCCACCATGGAGAGTGAGAGAGACTCAT
TGGCAAATTTTCAATCGGCAAGAGGATTCGAAGTTATCGATCAAGCCAAATCCGCTGTGGAGAGTGTGTGTCCAGGCGTAGTTTCTTGCGCTGATATTATTGCCGTTGCTGCCAGAGACG
CTTCTGAATAT
GTTAGTCTCTATCCATCTTTATATTCATACATCTCATTTGTTTCAACCATATTTACATATTAAACTACTATTTTAAATATCTTCAAGAAATATAGTATCTTCGTTTTTA
ACGTAAAACATCATGCATGTGTTACAAGTTTGCGATTGTATATTCGTTTTAACATAGTTCTAATTAATTCTTGAACATGTAAATTTTGGTATCATCAATAGGTCGGAGGTCCAAGATATA
ATGTGAAGGTTGGTCGAAGAGATTCCACTAACGCGTTTAGGGCAATTGCAGACAGCGGCGATCTCCCCAATTTTAGGGCAAGCCTCAACGATCTCTCTGAACTCTTCCTTAAAAAAGGAC
TCAACACTAGAGACCTCGTCGCTCTCTCAG
GTCGCTCACCATAAAAAAACACAGTTTTAGTCACTAATTTCTTAACATAATTAAGACATTCTTGTGACATAAGTTAACACTATTTACAGG
AGCTCACACCTTAGGGCAATCTCAATGCCTCACATTCAAGGGTAGACTTTACGACAACTCGAGTGACATTGACGCAGGATTCTCCAGCACACGTAAGCGTCGCTGCCCGGTCAACGGTGG
AGATACGACTCTAGCACCTCTAGATCAAGTGACACCAAATTCGTTTGACAATAACTATTACAGAAACTTGATGCAGAAGAAAGGACTTTTGGAGACTGATCAAGTTTTGTTCGGAACCGG
AGCTTCTACGGACAGTATTGTGACAGAGTACAGCAGAAATCCATCACGATTCGCGTCTGATTTCGGAGCTGCAATGATCAAAATGGGAGATATTCAGACACTCATTGGTTCAGATGGACA
AATCCGGAGGATATGCAGTGCCGTTAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATCTTCAAGATTCTTGTATTGTTGTTGAGTTTGTCTTGTTTCTGTCAAGCACAACTTTCTCCTTCTTTCTACGACCAAACTTGTCCAAATGCTCTCTCGACCATCCGGTCTTCA
ATCCGAACCGCAATCAGCCGTGAACGTAGAATGGCTGCTTCTCTCATCCGTCTCCATTTCCACGACTGCTTCGTTAAT
GGTTGTGATGCATCGGTCATGCTCGTGGCAACTCCCACCATG
GAGAGTGAGAGAGACTCATTGGCAAATTTTCAATCGGCAAGAGGATTCGAAGTTATCGATCAAGCCAAATCCGCTGTGGAGAGTGTGTGTCCAGGCGTAGTTTCTTGCGCTGATATTATT
GCCGTTGCTGCCAGAGACGCTTCTGAATAT
GTCGGAGGTCCAAGATATAATGTGAAGGTTGGTCGAAGAGATTCCACTAACGCGTTTAGGGCAATTGCAGACAGCGGCGATCTCCCCAAT
TTTAGGGCAAGCCTCAACGATCTCTCTGAACTCTTCCTTAAAAAAGGACTCAACACTAGAGACCTCGTCGCTCTCTCAG
GAGCTCACACCTTAGGGCAATCTCAATGCCTCACATTCAAG
GGTAGACTTTACGACAACTCGAGTGACATTGACGCAGGATTCTCCAGCACACGTAAGCGTCGCTGCCCGGTCAACGGTGGAGATACGACTCTAGCACCTCTAGATCAAGTGACACCAAAT
TCGTTTGACAATAACTATTACAGAAACTTGATGCAGAAGAAAGGACTTTTGGAGACTGATCAAGTTTTGTTCGGAACCGGAGCTTCTACGGACAGTATTGTGACAGAGTACAGCAGAAAT
CCATCACGATTCGCGTCTGATTTCGGAGCTGCAATGATCAAAATGGGAGATATTCAGACACTCATTGGTTCAGATGGACAAATCCGGAGGATATGCAGTGCCGTTAACTAA

Retrieve as FASTA