Entry information : AlyPrx26
Entry ID 7562
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2012-06-14 (Catherine Mathe)
Peroxidase information: AlyPrx26
Name AlyPrx26
Class Class III peroxidase    [Orthogroup: Prx027]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx26
start..stop
S start..stop
AhalPrx12 695 0 1..335 1..335
AtPrx26 677 0 1..335 1..335
BstrPrx74 661 0 1..335 1..335
CagraPrx40 659 0 1..335 1..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 21254814..21255059 246 N° 2 21255226..21255405 180 N° 3 21255486..21255645 160 N° 4 21255834..21256255 422
join(21254814..21255059,21255226..21255405,21255486..21255645,21255834..21256255 )


exon

Literature and cross-references AlyPrx26
DNA ref. JGI gene:   483456 Phytozome 11:   scaffold_4 (21254814..21256255)
mRNA ref. JGI transcript:   483456
Protein sequence: AlyPrx26
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (317)
PWM (Da):   %s   37451.87 (35552.9)  
PI (pH):   %s   8.83 (8.83) Peptide Signal:   %s   cut: 26 range:19-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVMIHIFLTAMVVGGVSLFPETAEATVMGPSMQKLTWHYYKVYNTCENAENFVRHQVEIFYKNDKSIAPKLLRLLYSDCFVSGCDASVLLEGPNSERMAPQNRGLGGFVLIDKIKIVLEQRCPGVVSCADILNLATRDAVHLAGAPSYPVFTGRRDGLTSDKHTVDLPSPSISWNQAMSYFKSRGLSVLDMATLLGSHSMGRTHCSYVVDRLYNYNKTGKPSPTMNKYFLSEMAKQCPPRTRKGQTDPLVYLNPDSGSNHSFTNSFYSRILSNKSVLEVDQQLLYNVDTKQISKEFSESFEDFRKSFALSISKVGAINVLTKTEGEIRKDCRRRN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 3 introns). Containing motif 'YSDC'.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTATGATTCATATCTTCCTCACCGCGATGGTGGTTGGAGGCGTTAGTCTCTTCCCGGAGACGGCAGAAGCGACCGTGATGGGACCGTCGATGCAGAAGCTTACGTGGCATTACTAC
AAAGTTTATAACACTTGCGAGAATGCAGAGAATTTTGTGAGGCACCAAGTTGAAATATTTTACAAGAACGATAAAAGTATTGCTCCCAAGCTCCTTCGTCTACTTTACTCCGATTGCTTT
GTCTCC
GTACGTTTTTTCGTACTCTTGTCTTATCATTTCTTATTATTCAATCATTTATATATATCATATGAACCCAAGGATATATAACTACAAAACTAATCGAGTGTTGAGAAAGTTTAA
TTAGAAGATTTACTAATTAGTCCTCTTACATTGTGTTACACTATAATGATAGGGATGCGATGCATCAGTTCTACTAGAAGGTCCGAACTCAGAGAGAATGGCGCCACAAAACAGAGGACT
TGGAGGATTCGTGCTTATAGACAAAATCAAAATAGTCTTGGAACAAAGATGTCCCGGTGTTGTCTCTTGCGCCGACATTCTTAATCTTGCAACTCGGGATGCTGTTCATTTG
GTAATCTC
TCTTTCTCTGCACCTATAACTATACATGGATCATTATAGATACTGACAAGCTGAGAGAAATGATTCACACAGGCAGGTGCACCATCTTATCCTGTGTTCACAGGCAGGAGAGATGGTTTG
ACCTCGGATAAGCACACCGTGGACCTACCATCGCCATCCATCTCATGGAACCAAGCCATGTCTTATTTCAAATCCAGAGGCTTGAGTGTTCTTGATATGGCTACACTTCTAG
GTCAGTCA
CCTTTTACTCCCTGCCAATATCTTAAAAACCGGTTTATCAGGATTTAGGAGTACTCATCCTGCGTTTCGGTCCAGTTTTCGAACTCTGTTTCGGATAGATATAGGTTTGGTTTCGGTTCA
TACTTGGATAGTAGTTTTGGTCTGGTTTGAATTGCTTAAACTGAATTACTCCCTCATCAGGATCACATTCAATGGGAAGAACACATTGCAGCTATGTCGTTGATCGACTCTACAATTACA
ACAAGACCGGTAAACCAAGCCCGACTATGAACAAGTATTTCCTGTCTGAAATGGCAAAGCAATGTCCTCCAAGAACGAGGAAAGGCCAGACCGATCCGCTAGTGTACCTAAACCCGGACT
CAGGCTCAAACCACAGCTTCACAAACTCATTCTATTCAAGAATTCTATCAAACAAATCTGTACTTGAAGTAGATCAACAACTGCTTTACAATGTTGACACCAAGCAAATATCTAAGGAAT
TCTCAGAGAGTTTTGAGGATTTCCGGAAATCATTTGCTCTTTCGATTAGCAAGGTGGGAGCGATAAATGTGTTAACTAAAACAGAAGGTGAGATACGAAAAGATTGCAGGCGTAGAAACT
AA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTATGATTCATATCTTCCTCACCGCGATGGTGGTTGGAGGCGTTAGTCTCTTCCCGGAGACGGCAGAAGCGACCGTGATGGGACCGTCGATGCAGAAGCTTACGTGGCATTACTAC
AAAGTTTATAACACTTGCGAGAATGCAGAGAATTTTGTGAGGCACCAAGTTGAAATATTTTACAAGAACGATAAAAGTATTGCTCCCAAGCTCCTTCGTCTACTTTACTCCGATTGCTTT
GTCTCC
GGATGCGATGCATCAGTTCTACTAGAAGGTCCGAACTCAGAGAGAATGGCGCCACAAAACAGAGGACTTGGAGGATTCGTGCTTATAGACAAAATCAAAATAGTCTTGGAACAA
AGATGTCCCGGTGTTGTCTCTTGCGCCGACATTCTTAATCTTGCAACTCGGGATGCTGTTCATTTG
GCAGGTGCACCATCTTATCCTGTGTTCACAGGCAGGAGAGATGGTTTGACCTCG
GATAAGCACACCGTGGACCTACCATCGCCATCCATCTCATGGAACCAAGCCATGTCTTATTTCAAATCCAGAGGCTTGAGTGTTCTTGATATGGCTACACTTCTAG
GATCACATTCAATG
GGAAGAACACATTGCAGCTATGTCGTTGATCGACTCTACAATTACAACAAGACCGGTAAACCAAGCCCGACTATGAACAAGTATTTCCTGTCTGAAATGGCAAAGCAATGTCCTCCAAGA
ACGAGGAAAGGCCAGACCGATCCGCTAGTGTACCTAAACCCGGACTCAGGCTCAAACCACAGCTTCACAAACTCATTCTATTCAAGAATTCTATCAAACAAATCTGTACTTGAAGTAGAT
CAACAACTGCTTTACAATGTTGACACCAAGCAAATATCTAAGGAATTCTCAGAGAGTTTTGAGGATTTCCGGAAATCATTTGCTCTTTCGATTAGCAAGGTGGGAGCGATAAATGTGTTA
ACTAAAACAGAAGGTGAGATACGAAAAGATTGCAGGCGTAGAAACTAA

Retrieve as FASTA