Entry information : AlyPrx56-2
Entry ID 7563
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx56-2
Name AlyPrx56-2
Class Class III peroxidase    [Orthogroup: Prx044]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx56-2
start..stop
S start..stop
AhalPrx50 671 0 1..331 1..331
BstrPrx35 557 0 1..329 1..329
AtPrx56 551 0 1..329 1..329
BstrPrx[P]71 550 0 1..330 1..340
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6184911..6185141 231 N° 2 6185229..6185414 186 N° 3 6185697..6185862 166 N° 4 6186083..6186495 413
join(6184911..6185141,6185229..6185414,6185697..6185862,6186083..6186495)


exon

Literature and cross-references AlyPrx56-2
DNA ref. Phytozome 12:   scaffold_6 (6184911..6186495)
Protein sequence: AlyPrx56-2
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (302)
PWM (Da):   %s   36530.93 (33339.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.41 (9.67) Peptide Signal:   %s   cut: 30 range:30-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAALKITIYCFFFLQVLLCLLSSCALTNAQGLKVGFYNKACPKAELVVKKSIFDMVKKDPSLGPPLLRLFFHDCFVRGCEGSVLLELKNKKAEKNAPPNLSLEGFDFIDNIKAALEKECPGIVSCSDVLALVARDVVVALNGPSWEVETGRRDGRVTNINEATSNMPSPFSNITTLITQFQSKGLNKKDLVVLSGAHTVGDAHCPIVRNRLYNFTGKGDSDPSLDKEYAARLRRKCKPTDTTTDLEMDPGSFTTFDKSYFKLVSKQRGLFQSDAALLNNQETKSYVLMQTKRYGSTFFKDFGVSMVKLGRIGVLTGRVGEVRKNCRMVNKY

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTTTGAAGATTACAATCTATTGTTTCTTCTTCCTTCAAGTACTATTGTGCTTGCTCTCTTCATGTGCTCTAACCAATGCACAAGGACTGAAAGTTGGGTTCTACAACAAGGCA
TGCCCGAAAGCCGAGCTTGTTGTTAAGAAGTCTATCTTCGACATGGTGAAGAAGGATCCATCACTTGGACCTCCTTTGCTTAGACTGTTCTTCCACGATTGCTTCGTTCGG
GTAATGTTC
ACAACGCTAATTTTTGAATCTGTCTTGTTTGGCACTTTATAGATCTAATGATTGAATCATGCATGCATGATATTTTAGGGATGTGAAGGGTCGGTCTTGCTAGAGTTAAAGAACAAAAAA
GCTGAGAAGAACGCGCCTCCTAACCTCAGCCTCGAAGGGTTTGATTTCATAGACAATATCAAGGCAGCTCTAGAAAAGGAATGTCCAGGCATTGTTTCTTGCTCAGATGTCTTGGCCCTT
GTTGCTAGAGACGTAGTGGTTGCG
GTAAGTATAAACGTTTAGTATCACTAACCGGTTCGAATGCAACAGATCTACGGAATAACAAGAAAAATTTGTGCTAGGGTGATGAGTACACCTTTT
ATGCTATAACATTTTATGAAAACTACGGTTTCAAGAGACTAGTTAGCTTTTGGTTTGACATTATTTGACTGATCTTAAAGAAATAGAATCAAGAAAAATTGTTATATATATGTGTGTGTG
TGTGTGTGTGTGTTGGACTATTAACATCATATATTATATATAACATAACAATCAATATATTTTTAGCTCAATGGACCGTCATGGGAAGTTGAAACGGGAAGAAGAGACGGTCGGGTTACA
AACATCAATGAGGCCACATCAAACATGCCATCGCCATTTTCTAATATAACTACTCTTATCACCCAATTCCAATCCAAAGGCCTCAACAAGAAAGACCTCGTCGTGCTTTCAG
GTATGTTC
TAGAATGAAAAAAATCAGATGATATACAAACGAAGATTCTATGAACAAACAAAAAGGTCACATAATAAAAACTAAAGAACAAAGAAACATCTTTTGGTATTGGGGTTTTGTCGAAGATAT
GATAGAATTGACCGGAAATTTGCAAAATCTGTTGATTAAAATAAAAATAAAAGTCATGCTCAACTAATTGCTATCTATTTACATTTTGACAGGTGCACACACGGTTGGGGACGCACATTG
TCCTATAGTCAGAAACAGGCTCTACAATTTCACCGGAAAAGGAGACAGTGATCCAAGCTTAGACAAGGAATATGCAGCCAGACTCAGAAGAAAATGTAAGCCGACCGATACCACGACAGA
TCTGGAAATGGATCCAGGAAGCTTCACAACATTTGATAAAAGCTACTTCAAGCTTGTGTCTAAACAAAGAGGGTTGTTTCAATCTGATGCAGCTCTTTTAAACAATCAAGAAACTAAATC
TTACGTTCTCATGCAAACGAAACGTTATGGTTCTACTTTCTTTAAGGACTTTGGTGTCTCCATGGTGAAGTTGGGTCGGATTGGAGTTTTAACGGGTCGAGTCGGTGAGGTTCGCAAGAA
TTGCAGAATGGTTAACAAGTACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTTTGAAGATTACAATCTATTGTTTCTTCTTCCTTCAAGTACTATTGTGCTTGCTCTCTTCATGTGCTCTAACCAATGCACAAGGACTGAAAGTTGGGTTCTACAACAAGGCA
TGCCCGAAAGCCGAGCTTGTTGTTAAGAAGTCTATCTTCGACATGGTGAAGAAGGATCCATCACTTGGACCTCCTTTGCTTAGACTGTTCTTCCACGATTGCTTCGTTCGG
GGATGTGAA
GGGTCGGTCTTGCTAGAGTTAAAGAACAAAAAAGCTGAGAAGAACGCGCCTCCTAACCTCAGCCTCGAAGGGTTTGATTTCATAGACAATATCAAGGCAGCTCTAGAAAAGGAATGTCCA
GGCATTGTTTCTTGCTCAGATGTCTTGGCCCTTGTTGCTAGAGACGTAGTGGTTGCG
CTCAATGGACCGTCATGGGAAGTTGAAACGGGAAGAAGAGACGGTCGGGTTACAAACATCAAT
GAGGCCACATCAAACATGCCATCGCCATTTTCTAATATAACTACTCTTATCACCCAATTCCAATCCAAAGGCCTCAACAAGAAAGACCTCGTCGTGCTTTCAG
GTGCACACACGGTTGGG
GACGCACATTGTCCTATAGTCAGAAACAGGCTCTACAATTTCACCGGAAAAGGAGACAGTGATCCAAGCTTAGACAAGGAATATGCAGCCAGACTCAGAAGAAAATGTAAGCCGACCGAT
ACCACGACAGATCTGGAAATGGATCCAGGAAGCTTCACAACATTTGATAAAAGCTACTTCAAGCTTGTGTCTAAACAAAGAGGGTTGTTTCAATCTGATGCAGCTCTTTTAAACAATCAA
GAAACTAAATCTTACGTTCTCATGCAAACGAAACGTTATGGTTCTACTTTCTTTAAGGACTTTGGTGTCTCCATGGTGAAGTTGGGTCGGATTGGAGTTTTAACGGGTCGAGTCGGTGAG
GTTCGCAAGAATTGCAGAATGGTTAACAAGTACTGA

Retrieve as FASTA