Entry information : AlyPrx[P]63
Entry ID 7566
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyPrx[P]63
Name AlyPrx[P]63
Class Class III peroxidase     [Orthogroup: Prx009]*
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyPrx[P]63
start..stop
S start..stop
AlyPrx63 263 6e-89 1..154 1..144
AlyPrx63 73 5e-16 154..188 227..261
AtPrx63 238 3e-79 1..154 1..144
AtPrx63 73 6e-16 154..188 227..261
CrubPrx80 236 2e-78 1..154 1..144
CrubPrx80 74 4e-16 154..188 227..261
CagraPrx18 235 3e-78 1..154 1..144
CagraPrx18 74 4e-16 154..188 227..261
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3302998..3303214 217 N° 2 3303755..3304119 365  
join(3302998..3303214,3303755..3304119)


exon

Literature and cross-references AlyPrx[P]63
DNA ref. Phytozome 12:   scaffold_4 (3302998..3304119)
Protein sequence: AlyPrx[P]63
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   193 (166)
PWM (Da):   %s   20904.59 (17924.1)  
PI (pH):   %s   6.48 (7.21) Peptide Signal:   %s   cut: 28 range:28-193
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAEQSQLNNLTINIIILCFTFQSLSSAAESHLTVDFYSKSCLKFLDIIRETITNKQISTPTTAAARGVKRANTAAALRLFFHDCFPNGCDASVLVSSTTFNTAERDSSINLFLPGDGFDVVIRAKTALELACPNTVSCSDIIAVAVRDLLVTVAVALKKACSNYKNDPTISVFNDVMTPNKFDNMYLQTNSII

Retrieve as FASTA  
Remarks Pseudogene. Sequence from genomic (chromo). exons 1, 2 and part of exon 4.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGAACAATCTCAACTCAATAATCTCACCATCAACATCATCATCCTCTGCTTCACCTTCCAATCACTATCCTCCGCCGCCGAATCTCACCTCACCGTCGATTTCTACTCCAAATCT
TGCCTTAAATTCCTCGACATTATCCGCGAAACCATCACCAACAAACAGATCTCAACTCCAACGACCGCCGCCGCTAGAGGTGTCAAGCGGGCCAATA
GCCCGCGGGTTTCGTCCAAGTAG
CCCATGGCGGGGCGGGCTTGGACATTAAATTTTTTGTCCATAGATTAGCGGGCCTAGCGGACAGGCCCATTGCGGATCGCGGATTCAAGCGGGTAAGCCCGTTGCGGATTGCGGGTTTGC
GGGTTGCCCGCGAAAGAGAAACCAACTCTTTTAAAACCTTTTGTTTCTCGTAGATTTTTTCAAAGTTTGAGTTTCAAACCTCTATTTCAAACCTTTTGTCTCTGTTAGAGTTTCTTGTGC
AATTCAAAAACCCTAATCATTAATCAAAGTGACTTCACGATCAATTGCTTAACAAGGAAACTGAAGAGTCATTCTCTATCTCTTCAAGTTTCTTTTTTACGACCACATCCAAAAAATTTA
GATCGTCGAAGCTTCAGATTTCAAGTCAAAAAAGAGCAACTGAGAACTACACACTTGTAATGGTAAGTTATTTAGATGTTTTACTTTTGTTTGATTGATTCTCTCTAGTCGTGAGTCGTG
CTAGATGGGCGCGGGCTGGCCCGTCTGACACCTCTAGCCGCCGCAGCTCTCCGCCTCTTCTTCCACGACTGTTTCCCTAACGGCTGCGATGCCTCCGTCCTCGTTTCCTCAACCACTTTC
AACACCGCCGAACGCGATTCATCAATCAACCTCTTTCTCCCCGGCGACGGATTCGACGTCGTGATCCGCGCTAAAACAGCTCTAGAACTCGCTTGTCCCAACACAGTCTCTTGCTCTGAT
ATCATCGCCGTCGCGGTACGTGATCTCCTCGTCACCGTCGCGGTAGCTTTAAAGAAAGCTTGTTCGAATTACAAAAATGACCCTACGATCTCTGTCTTTAACGACGTTATGACTCCAAAC
AAATTCGATAATATGTATCTCCAAACAAATTCGATAATATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGAACAATCTCAACTCAATAATCTCACCATCAACATCATCATCCTCTGCTTCACCTTCCAATCACTATCCTCCGCCGCCGAATCTCACCTCACCGTCGATTTCTACTCCAAATCT
TGCCTTAAATTCCTCGACATTATCCGCGAAACCATCACCAACAAACAGATCTCAACTCCAACGACCGCCGCCGCTAGAGGTGTCAAGCGGGCCAATA
CCGCCGCAGCTCTCCGCCTCTTC
TTCCACGACTGTTTCCCTAACGGCTGCGATGCCTCCGTCCTCGTTTCCTCAACCACTTTCAACACCGCCGAACGCGATTCATCAATCAACCTCTTTCTCCCCGGCGACGGATTCGACGTC
GTGATCCGCGCTAAAACAGCTCTAGAACTCGCTTGTCCCAACACAGTCTCTTGCTCTGATATCATCGCCGTCGCGGTACGTGATCTCCTCGTCACCGTCGCGGTAGCTTTAAAGAAAGCT
TGTTCGAATTACAAAAATGACCCTACGATCTCTGTCTTTAACGACGTTATGACTCCAAACAAATTCGATAATATGTATCTCCAAACAAATTCGATAATATGA

Retrieve as FASTA