Entry information : AlyGPx04
Entry ID 7569
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyGPx04
Name AlyGPx04
Class Plant glutathione peroxidase    [Orthogroup: Gpx2002]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyGPx04
start..stop
S start..stop
AtGPx04 348 2e-125 1..170 1..170
BnGPx04_other 333 2e-119 1..170 1..170
BnGPx05_other 308 2e-109 1..169 1..169
BrGPx05_other 306 5e-109 1..169 1..169
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 23321568..23321621 54 N° 2 23321713..23321789 77 N° 3 23321866..23321927 62 N° 4 23322014..23322132 119
N° 5 23322280..23322447 168 N° 6 23322528..23322560 33  
join(23321568..23321621,23321713..23321789,23321866..23321927,23322014..23322132 ,23322280..23322447,23322528..23322560)


exon

Literature and cross-references AlyGPx04
DNA ref. Phytozome 11:   scaffold_4 (23321568..23322560)
Protein sequence: AlyGPx04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   170
PWM (Da):   %s   19140.87  
PI (pH):   %s   9.53
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGASASVPERSVHQFTVKDSSGKDLNLSIYQGKVLLIVNVASKCGFTETNYTQLTELYRKFKDDFEILAFPCNQFLYQEPGTSQDAHEFACTRFKAEYPVFQVRVNGQNAAPLYKFLKASKPTFLGSRIKWNFTKFLVGKDGLVIDRYGTMVTPLSIEKDIKKALEDA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCTTCTGCTTCGGTTCCCGAGAGATCCGTCCATCAATTCACTGTAAAGGTATTCTCTTTTCGCTCATACTAGAGGAGGAGGTTGAATCGTCGCTCTGATATTATTTATTTATTC
CTTGTTCTTGTTTCCTGGGAATCAGGATAGCTCCGGCAAGGACCTGAATTTGAGCATTTACCAAGGAAAAGTCCTCCTCATCGTCAATGTTGCTTCCAAATGGTTCGTCTCTTTTTTTGG
TCTTTCCCAAATTTTGCTATTTTCTTATTCACCGTTACTCCTTGGTTTGTACAAACAGCGGTTTCACCGAAACAAACTATACCCAGCTCACCGAACTTTACCGGAAATTCAAGGACCAAG
GTCATGATTATTTTAGAGCTTTTGTTATGCAGTTGCAAGCTCATCTCCTTTGCTGGTTTTACCATTTCATGCTCTCTTGTTTTCAGATTTTGAGATCTTGGCATTCCCTTGCAACCAGTT
TCTATACCAGGAGCCCGGCACAAGTCAAGATGCTCATGAATTTGCCTGCACACGCTTTAAGGCCGAATACCCTGTTTTCCAAAAG
GTAGGTAGGGATCAAGACTCTTGGAACACGTTTAT
TATAGCTCCTCAACTTATTATGTTAGGCAGCTGTGACTTGTGGTACGTTCGTTTCGTTTTAACAAGAAATTCATAAACACTAACTAGTTGTGTTTTGTGAATGTGGGCTTAGGTACGCGT
AAACGGTCAAAACGCAGCACCACTCTATAAATTCCTGAAGGCAAGTAAACCCACCTTTCTGGGTTCCAGGATAAAGTGGAACTTCACCAAGTTCTTGGTCGGCAAAGATGGCTTAGTGAT
TGATCGTTATGGCACGATGGTTACACCGCTATCAATCGAG
GTATTCGTGCTTTATGTATCCAAAGTACCCATGTAATATGTTGTCATTGTCGTGATCCGGTTTCCTTCTTTTGTGAGCAG

AAAGACATCAAGAAAGCTCTTGAAGACGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCTTCTGCTTCGGTTCCCGAGAGATCCGTCCATCAATTCACTGTAAAGGATAGCTCCGGCAAGGACCTGAATTTGAGCATTTACCAAGGAAAAGTCCTCCTCATCGTCAATGTT
GCTTCCAAATG
CGGTTTCACCGAAACAAACTATACCCAGCTCACCGAACTTTACCGGAAATTCAAGGACCAAGATTTTGAGATCTTGGCATTCCCTTGCAACCAGTTTCTATACCAGGAG
CCCGGCACAAGTCAAGATGCTCATGAATTTGCCTGCACACGCTTTAAGGCCGAATACCCTGTTTTCCAAAAG
GTACGCGTAAACGGTCAAAACGCAGCACCACTCTATAAATTCCTGAAG
GCAAGTAAACCCACCTTTCTGGGTTCCAGGATAAAGTGGAACTTCACCAAGTTCTTGGTCGGCAAAGATGGCTTAGTGATTGATCGTTATGGCACGATGGTTACACCGCTATCAATCGAG
AAAGACATCAAGAAAGCTCTTGAAGACGCTTGA

Retrieve as FASTA