Entry information : AlyGPx01
Entry ID 7573
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyGPx01
Name AlyGPx01
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyGPx01
start..stop
S start..stop
AtGPx01 444 4e-161 17..236 17..236
BnGPx01_other 413 5e-149 4..236 1..236
ThasGPx01 371 2e-132 9..236 2..235
AtGPx07 357 5e-127 10..236 4..233
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3674746..3675000 255 N° 2 3675282..3675358 77 N° 3 3675470..3675531 62 N° 4 3676051..3676169 119
N° 5 3676239..3676406 168 N° 6 3676496..3676525 30  
join(3674746..3675000,3675282..3675358,3675470..3675531,3676051..3676169,3676239 ..3676406,3676496..3676525)


exon

Literature and cross-references AlyGPx01
DNA ref. Phytozome 11:   scaffold_4 (3674746..3676525)
Protein sequence: AlyGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   236
PWM (Da):   %s   26006.29  
PI (pH):   %s   9.94
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVSMTTSSSSYAPFSTVFNSSRPNSSATFLVPSFKFSTGISNFANLSNGFSLKSPINPGFLFKSRPFTVQARAAAEKTVHDFTVKDIDGKDVALNKFKGKVMLIVNVASRCGLTSSNYSELSHLYEKYKSGFEILAFPCNQFGFQEPGSNSEIKQFACTRFKAEFPIFDVDVNGPSTAPIYEFLKSNAGGFLGGLIKWNFEKFLIDKKGKVVERYPPTTSPFQIEKDIQKLLAA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTCCATGACTACTTCTTCTTCTTCATACGCACCATTCTCTACAGTCTTCAACAGTTCCAGACCTAATTCATCTGCAACCTTTCTCGTCCCTTCCTTCAAATTCTCCACCGGAATA
TCGAATTTCGCGAATCTGAGTAATGGGTTTTCTCTAAAATCTCCAATTAATCCTGGGTTTCTCTTCAAGTCCCGTCCTTTCACTGTTCAAGCTAGAGCTGCTGCAGAAAAGACCGTTCAC
GACTTCACCGTTAAG
GTTTGGTTCTTTTTCTTTTACCCAATTCAGACCAAAAAACTAGGGTTCTCTAAAATCTGTCTGCTCTTTACTAAATTGGGAATCTTCAAATTTGCAATGAAGTTC
ATAGTGATTTCAATTGGTGACGTATATAAAAATCTGAACTTTGAGACATAAGTGTATAGTAAAAGCTCAAGCTCAAGTATTTTAGGTTCATATTTTTATTGAATTTCGTAGTGTATATAT
ATACTTAGGTTAGTGATTTCAATTAGAGACATAATTGGATTCTTTTTTGGAGGCAGGACATTGATGGGAAAGATGTTGCTTTGAACAAATTCAAGGGGAAAGTTATGTTGATTGTCAATG
TTGCTTCAAGATG
GTAAAGCTTCTCCTTCTTCATCCTCTGTGATGCGATTTTTAGAAGTCGTTTTTGATGATAGTTCATGTAGAGGTTTTTGAGCTTAAAGATTGTGTTTTCATGAATAT
ACAGTGGTTTGACATCATCAAATTACTCAGAGCTTTCACATCTGTACGAGAAATACAAAAGCCAAGGTGAGCTCTAACTAGCTTCTACACATTGTGATCTATTCGTTGCAATCGATTTGC
AACCAGTGGGGTCTTTTGTTTAATCTTGTTCTTGGAGTTTATTTGTGTATTCGCATTATCCCATTTTGATGGTTCGTTCATTTTTCAGTGCCGTTTTGGGCATTTTGGTGTTTGGTTACT
TACTGAAAATTCCTCTTGTTTTGTGTTCAGTTAATTGTTCTGTAGATCTTTATATCATTCTTGGTGTCAATATGATTTGGTCCTATTGTTGCTCCTACTACGGCGATGTTACTAGGTTGT
GGTTTAACTTAATTTATGGAAATTAATTGTTCTGCAATTTTGAACTGGAAGCGAATTCAGCATCTTTGTTGGATTGATGATAATCGCACTCATCCGTTCTCCATAGCTAAAAGAATTTTC
TTGAAATTACGGATCTTTTCATTAATCATTTAGGGGGCAATAAGCCAATGTACGTGTATTTTTCATGCATTTGCAGTTAATAACACTAACTTGTTTGGATTACAGGATTTGAGATTCTAG
CTTTTCCCTGCAATCAGTTTGGTTTCCAAGAGCCCGGGTCAAACTCGGAGATCAAACAATTCGCTTGCACTCGGTTTAAAGCAGAGTTCCCTATATTTGATAAG
GTATAAATAATCCAAA
ACATTCACCCTTGTTTTCAGGTTGCAGATTAGAATAAAGTTTAAATCCGACAGGTTGACGTAAATGGACCAAGCACAGCGCCCATCTACGAATTCTTGAAATCAAACGCAGGAGGATTCT
TGGGTGGTCTCATTAAATGGAACTTTGAGAAGTTTTTGATTGATAAAAAGGGAAAGGTCGTTGAGAGGTACCCTCCCACCACATCCCCTTTCCAAATCGAG
GTACAGTTAAGGGACTACT
TCCAATTCGGTTCATAGCGGTTTGATTCCCGGCTTGTAACCAAATCGTATTTGTTTCGGCTGTTTTGCAGAAAGACATCCAGAAGTTGCTTGCCGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTCCATGACTACTTCTTCTTCTTCATACGCACCATTCTCTACAGTCTTCAACAGTTCCAGACCTAATTCATCTGCAACCTTTCTCGTCCCTTCCTTCAAATTCTCCACCGGAATA
TCGAATTTCGCGAATCTGAGTAATGGGTTTTCTCTAAAATCTCCAATTAATCCTGGGTTTCTCTTCAAGTCCCGTCCTTTCACTGTTCAAGCTAGAGCTGCTGCAGAAAAGACCGTTCAC
GACTTCACCGTTAAG
GACATTGATGGGAAAGATGTTGCTTTGAACAAATTCAAGGGGAAAGTTATGTTGATTGTCAATGTTGCTTCAAGATGTGGTTTGACATCATCAAATTACTCAGAG
CTTTCACATCTGTACGAGAAATACAAAAGCCAAG
GATTTGAGATTCTAGCTTTTCCCTGCAATCAGTTTGGTTTCCAAGAGCCCGGGTCAAACTCGGAGATCAAACAATTCGCTTGCACT
CGGTTTAAAGCAGAGTTCCCTATATTTGATAAG
GTTGACGTAAATGGACCAAGCACAGCGCCCATCTACGAATTCTTGAAATCAAACGCAGGAGGATTCTTGGGTGGTCTCATTAAATGG
AACTTTGAGAAGTTTTTGATTGATAAAAAGGGAAAGGTCGTTGAGAGGTACCCTCCCACCACATCCCCTTTCCAAATCGAG
AAAGACATCCAGAAGTTGCTTGCCGCTTAA

Retrieve as FASTA