Entry information : AlyGPx02
Entry ID 7574
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-24 (Marie Brette (Scipio))
Peroxidase information: AlyGPx02
Name AlyGPx02
Class Plant glutathione peroxidase    [Orthogroup: Gpx2003]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyGPx02
start..stop
S start..stop
AtGPx02 341 8e-123 1..169 1..169
BnGPx02-2_other 333 1e-119 1..169 1..169
BnGPx02-1_other 326 1e-116 1..169 1..169
BrGPx02_other 323 1e-115 1..169 1..170
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14917510..14917554 45 N° 2 14917223..14917299 77 N° 3 14916837..14916898 62 N° 4 14916633..14916751 119
N° 5 14916269..14916436 168 N° 6 14916142..14916180 39  
complement(join(14916142..14916180,14916269..14916436,14916633..14916751,1491683 7..14916898,14917223..14917299,14917510..14917554))


exon

Literature and cross-references AlyGPx02
DNA ref. Phytozome 11:   scaffold_4 (14917554..14916142)
Protein sequence: AlyGPx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   169
PWM (Da):   %s   18886.73  
PI (pH):   %s   6.62
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MADESPKSIYDFTVKDIGGNDVSLNQYKGKTLLIVNVASKCGLTDANYKELNVLYEKYKEGLEILAFPCNQFLGQEPGNNEEIQQTVCTRFKAEFPIFDVDVNGKNTAPLYKYLKAEKGGLLIDAIKWNFTKFLVSPDGKVLQRYSPRTSPLQFEKDVQTLLGQASS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 5 introns). Also found in scaffold_762.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGATGAATCTCCAAAGTCTATCTACGACTTCACCGTCAAGGTTTTTTCTCTCAATGTTTTTTTTTTTTCATTATTGTTAGTCTTAGATTCTTAATTCAAATAAACAGAAAAACCA
TAAGGTTTGATCCAAAAATAAGATAGCGAAATTTTCAAAGTTCGATCTCAGGCAAAAGAATATAGATGAAGAATTAAGGTTTGTTATAAAAAAAAAAAACTATGTGTGTTTATATTTTAT
TCATGAAAATGGCAGGATATCGGAGGTAACGATGTGAGTTTGAACCAATACAAAGGCAAAACTCTTCTGATTGTCAATGTTGCTTCCAAATGGTAAAAATCCTTTTTCACTGTCAATTTA
TTTATTTTTATTTTTGTTAGAAGCCATTGCCTAGTTATATATGCAAGATAGTATTTGTAATCTACCAGATTCAAAATATATATAAACGTAAGGATCTTGTGAAATTAGTAGTTGATCAAT
CCGGTTCAGTTTGGTTTGATTAGTACCTGTCCTTTGTTCTTAACTGCGATATTGCTTTGTTAAAATATAAACAAAGATTCTAGTCATATTGGTCTTCGTTTGTTCAAATTTCAAGATTTT
GCTTAAAGTCAATCAAATAGATGAAATAAAAACTGAAATTTCTTATTAACTTGCAGTGGTCTGACTGATGCCAACTACAAGGAACTGAATGTTCTGTACGAGAAATACAAGGAGCAAGGT
CTGTGATTTATATCTACTCTCACAAAATTTAACCCGGTTTTAATTGTGACTGGAACTAAATACATGTAACAAATTATGAATAGGGTTGGAGATATTAGCATTCCCTTGTAACCAGTTCTT
AGGACAAGAACCAGGTAACAATGAAGAGATTCAACAAACTGTCTGCACCAGGTTCAAAGCTGAATTCCCCATCTTTGACAAG
GTAATTCATTTTGTCTTTATCACACTTCTCTATTTCAT
TGATTAATGTTTTACTAATGATTGATCTTTACAACATTATTAAGAGATGTGAGTTTGTGTATAAGTAACTTAATGAGGAATGATGATTGTCTAATAGTGAAAGAAAAAGAGTAGTGTATA
TATATAAATACTTGACGGAAATGTTGATGGCAATGTAGGTGGATGTGAACGGGAAAAACACGGCGCCATTATACAAATACTTGAAAGCAGAGAAAGGAGGTTTGCTCATTGATGCCATCA
AATGGAATTTCACCAAATTCTTGGTTTCTCCTGATGGCAAAGTCTTACAGAGATATTCTCCCAGAACCTCTCCTCTTCAATTCGAG
GTACGTACCATCCTGGCTTTCACCTAAACCGGAA
TCCATCCATACACAACCATCTTAATAATGACCGGTTTGTTTTTGGTTTATGCAGAAGGACGTTCAAACTCTGTTGGGACAGGCTTCTTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGATGAATCTCCAAAGTCTATCTACGACTTCACCGTCAAGGATATCGGAGGTAACGATGTGAGTTTGAACCAATACAAAGGCAAAACTCTTCTGATTGTCAATGTTGCTTCCAAA
TG
TGGTCTGACTGATGCCAACTACAAGGAACTGAATGTTCTGTACGAGAAATACAAGGAGCAAGGGTTGGAGATATTAGCATTCCCTTGTAACCAGTTCTTAGGACAAGAACCAGGTAAC
AATGAAGAGATTCAACAAACTGTCTGCACCAGGTTCAAAGCTGAATTCCCCATCTTTGACAAG
GTGGATGTGAACGGGAAAAACACGGCGCCATTATACAAATACTTGAAAGCAGAGAAA
GGAGGTTTGCTCATTGATGCCATCAAATGGAATTTCACCAAATTCTTGGTTTCTCCTGATGGCAAAGTCTTACAGAGATATTCTCCCAGAACCTCTCCTCTTCAATTCGAG
AAGGACGTT
CAAACTCTGTTGGGACAGGCTTCTTCTTGA

Retrieve as FASTA