Entry information : AlyGPx07
Entry ID 7575
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2011-01-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-27 (Christophe Dunand)
Peroxidase information: AlyGPx07
Name AlyGPx07
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyGPx07
start..stop
S start..stop
AtGPx07 404 3e-145 1..236 1..233
BnGPx01_other 351 2e-124 8..236 11..236
AlyGPx01 343 1e-121 5..236 11..236
BnGPx07_other 342 5e-121 2..236 3..232
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4146551..4146805 255 N° 2 4146266..4146342 77 N° 3 4146055..4146116 62 N° 4 4145841..4145959 119
N° 5 4145604..4145771 168 N° 6 4145337..4145363 27  
complement(join(4145337..4145363,4145604..4145771,4145841..4145959,4146055..4146 116,4146266..4146342,4146551..4146805))


exon

Literature and cross-references AlyGPx07
DNA ref. Phytozome 11:   scaffold_7 (4146805..4145334)
Protein sequence: AlyGPx07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   236
PWM (Da):   %s   25814.31  
PI (pH):   %s   10.12
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ASFYASFATVFNGFAANPPPNSSAILVPSLRFSTGTSNTRNISGLGNGVSLKSSNNHRFLVKSRNFGVYARAAAEKTVHDFTVKVIDGNDVSLDKLKGKPLLIFNVASRWCLTSSNFSELSHLYEKYKNQVEILALPCNQFGGQ*PGSNPEIKQFACTRFKVEFPIFDKDVNGTSTAPIYKFLKSNAGGFLGDIIKWNFEKFLVDKEGKVVERYPPTTSPFQNRGDIQKLLAA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, 6 introns). Stop codon in frame and extra 5' intron (9 nt)(=> sequencing error!).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCCTCCTTTTACGCATCATTCGCTACTGTCTTCAATGGTTTCGCTGCAAACCCACCTCCGAATTCTTCGGCTATTCTCGTCCCTTCATTGAGATTCTCCACCGGAACATCAAATACTCGG
AATATATCTGGGTTAGGTAATGGGGTTTCCCTGAAATCGTCGAATAATCATAGGTTTCTAGTCAAATCCAGAAATTTTGGTGTTTATGCAAGAGCTGCTGCAGAGAAAACTGTTCACGAT
TTCACTGTAAAGGTA
TGTTTCTCTTTCTTAATTTATCTGAAGAAGAAAATTAGGTTTTTGTTTCTTCGTTAGCTTTAAATGCTATCGAAACGGAAGAATTTGGTCTGCCATCAAAATATG
ATTTTTCTTAATCTCACTGAATTATGTAGTACTCCTTCCTAACTAAAACCTAGACTTGGAGACATAATTATGTTTTGTTTTTTAATAATGACTGGGACAGTACATAGATGGGAATGATGT
TTCTCTGGACAAATTGAAAGGAAAACCTCTGTTGATCTTTAACGTCGCTTCAAGATGGTG
ATCATTGTTTTACTATTGTTCATTCGAATGCTATTTTTTTTTTTTTTTTTTTGCCATACC
ATTCGAATGCTATTTGATAATTTGATTTTGCTTCTAAAAAAAATTTTAAAAAGTGTTTTTTTTTTTGTTTTGCTTTACTGTTTCAGTGGTTTGACATCATCAAATTTCTCGGAGCTTTCT
CATCTGTACGAAAAATACAAGAACCAAGGTG
TGCTTTTATAGTAAGCTTTTTAATATCTAATTTAATTAAGGTAACACATTGATTGTGACCTTCTCATCATTTATTGTGTGTCTCAATTT
TAGGATTTGAGATTCTTGCTCTCCCTTGCAATCAATTTGGAGGTCAATAACCCGGTTCAAACCCTGAGATCAAGCAATTTGCTTGCACCCGATTCAAAGTGGAGTTCCCTATATTCGACA
AGGTA
TGTAGGAAAAAATAGAACTCTCATTTTGGAGGTTTGAGAGAGATCTTCTAATGTTGTGTTCTTCAGGTTGATGTCAATGGAACAAGCACAGCTCCCATCTACAAGTTCTTGAAAT
CTAATGCTGGTGGTTTTCTTGGTGATATCATCAAATGGAACTTTGAGAAATTCTTGGTTGATAAGGAGGGCAAAGTTGTCGAGAGATACCCTCCCACGACTTCTCCTTTCCAAAATCGAG
GT
ACCAATTCAAAACTCTCTATTCAATCTGAATAACTGGATCCTTGGTTTATGTCGTTTCCGGTTTGGTCCATGGTTCATGTCGTGAACCAAACCAGTTGGACTATTCTAATGTACATAG
AGAATCTTTCAATTGATAACATCTCTAACATATATAACATTAATTTTTCCATGTGGCACGGCGGAATGTTGAGTGAGTCGTCTTAGTATTTTAATACTAACAATTTGTTTGTTTGGCAGA
AGGACATCCAGAAGTTGCTTGCGGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCCTCCTTTTACGCATCATTCGCTACTGTCTTCAATGGTTTCGCTGCAAACCCACCTCCGAATTCTTCGGCTATTCTCGTCCCTTCATTGAGATTCTCCACCGGAACATCAAATACTCGG
AATATATCTGGGTTAGGTAATGGGGTTTCCCTGAAATCGTCGAATAATCATAGGTTTCTAGTCAAATCCAGAAATTTTGGTGTTTATGCAAGAGCTGCTGCAGAGAAAACTGTTCACGAT
TTCACTGTAAAGGTA
ATAGATGGGAATGATGTTTCTCTGGACAAATTGAAAGGAAAACCTCTGTTGATCTTTAACGTCGCTTCAAGATGGTGTTTGACATCATCAAATTTCTCGGAGCTT
TCTCATCTGTACGAAAAATACAAGAACCAAGGTG
TTGAGATTCTTGCTCTCCCTTGCAATCAATTTGGAGGTCAATAACCCGGTTCAAACCCTGAGATCAAGCAATTTGCTTGCACCCGA
TTCAAAGTGGAGTTCCCTATATTCGACAAGGTA
GATGTCAATGGAACAAGCACAGCTCCCATCTACAAGTTCTTGAAATCTAATGCTGGTGGTTTTCTTGGTGATATCATCAAATGGAAC
TTTGAGAAATTCTTGGTTGATAAGGAGGGCAAAGTTGTCGAGAGATACCCTCCCACGACTTCTCCTTTCCAAAATCGAGGT
GACATCCAGAAGTTGCTTGCGGCTTAA

Retrieve as FASTA