Entry information : AlyRboh[P]B
Entry ID 7582
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2010-08-11 (Christophe Dunand)
Peroxidase information: AlyRboh[P]B
Name AlyRboh[P]B
Class Respiratory burst oxidase homolog     [Orthogroup: AhpD002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyRboh[P]B
start..stop
S start..stop
CsRboh03 1073 0 21..777 49..889
CclRboh03 1073 0 21..777 49..889
EglRboh04 1053 0 4..777 12..889
MtRboh03 1032 0 2..777 10..885
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3476054..3476423 370 N° 2 3476576..3476736 161 N° 3 3476845..3476892 48 N° 4 3476990..3477103 114
N° 5 3477242..3477677 436 N° 6 3477830..3478216 387 N° 7 3478343..3478441 99 N° 8 3478458..3478490 33
N° 9 3478583..3478656 74 N° 10 3478734..3479233 500 N° 11 3479315..3479421 107  
join(3476054..3476423,3476576..3476736,3476845..3476892,3476990..3477103,3477242 ..3477677,3477830..3478216,3478343..3478441,3478458..3478490,3478583..3478656,34 78734..3479233,3479315..3479421)


exon

Literature and cross-references AlyRboh[P]B
DNA ref. Phytozome 11:   scaffold_1 (3476054..3479421)
Protein sequence: AlyRboh[P]B
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   776
PWM (Da):   %s   88501.13 Transmb domain:   %s   o292-311i433-455o475-497i596-613o
PI (pH):   %s   9.79
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MESWSEEEKIKISRCKATGPENSEEDDVEITLEVRDESISTTKAKATLRSVLSGRLKTMVKTLSFASRRLDRSK*SGAMFALRGLRFIAKTDAVGRGWDEVATRFDQLAVEGKLPKSKFGHCIGMVESSEFVNELFETLVRRRGTSSSSITKTELFEFWEQITGNSFDARLQIFFDVDKNLDGRITGDEVKEIIALSASANKLSKIKENVDEYAALIMEELDRNNLGYIELHNLETLLLQVPSQSNNSPSSANKRALNKMLSQKLIPTKDRNPVKRFARNISYYFLENWKRIWVLTLWISICIALFTWKFLQYKRKTVFEVLGYCVSVAKGSGDLEIQHGSHPLARL*EHYNLAKDQVKAYWVRCSI**QHQFPQGYCVWDRNWNWLTRHISPGMRFPAFVACKKCRI*ASKKVFRRREAGQLRMVHERDRWLDRSHHGGSNGSGLRLGAVLVQTQPGKPTKIVETIDGFQRVLVLAPFVCHRLCASNRAWLFYLSLQGMVPQDDVDVSGCFRSTICI*TIDSCI*TRCQGCQDFKGVDIATQILIFQGLSTSLDKSKWALHS*HRSSQQYNVSEAVNRWSIWSTSTRLPALRCIASGRSRDRSDAINQHNQGRP*QHQEPEIDRTRH*PTHKKLCCHKTSLFLLGNKRARIIGMVQ*GHERGS*VR*RGDD*TT*LLYERV*GRRREVSTNHNVAVIAPCQERH*HRIGHAGPNPFRSSRLA*RLQARCCQPRQSTSWGFLLW*YMHHRRVKETSSRFL*ENYDQV*VPQGX

Retrieve as FASTA  
Remarks Pseudogene. Sequence from genomic (chromo 1). Codon in frame and missing sequence between KILKV and WTSQL.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAATCTTGGTCAGAAGAAGAGAAAATCAAGATTTCCCGATGCAAAGCCACTGGTCCAGAAAATTCTGAAGAGGACGACGTCGAGATCACACTCGAAGTGCGAGACGAAAGCATCAGC
ACAACGAAGGCCAAGGCGACACTTCGGTCTGTTCTTTCCGGGAGACTAAAAACGATGGTGAAGACGTTGTCGTTTGCTTCACGCCGGCTCGACCGTAGTAAGTAATCCGGTGCTATGTTT
GCTCTTCGAGGTTTGAGGTTCATTGCCAAAACCGACGCCGTTGGCAGAGGCTGGGATGAGGTTGCAACGAGGTTCGATCAGTTGGCCGTTGAAGGGAAGCTCCCTAAATCCAAATTTGGA
CATTGCATAG
GTGAAAAATCTCTAAATAATATACTTTTTGGTTTTTTTAATTTTGTTTTTGGTAATTACACTCCAATGTAAGGCTCAACTTATTTCCCATATAATATTATATATTTGTTA
TCTTTTAACGTAAATTTTAAAAGAATTATTTCAACTAAATAGGAATGGTTGAATCTAGCGAATTTGTGAACGAGCTTTTTGAGACGTTGGTCCGAAGGAGAGGGACTTCGTCATCGTCAA
TCACCAAAACTGAATTGTTTGAATTTTGGGAGCAGATCACAGGCAATAGCTTTGATGCTAGACTGCAAATCTTTTTTGATATG
TAAGCATATTTATTTCTAGTATTTGAATAGTATAATG
CATGATTATCATTTATTATAAAATATGGTAAGTTGAGTAGTTATTTCTTTGTGTTTATGTAAATATATAAGGTGGACAAAAATTTGGACGGACGTATTACTGGAGATGAGGTTAAGGAGG
TGAAAGATAAATTAATAGCGATACCTAATTATATTTCGTTAGAGTCCTAATAAAAAGAAAAGTTAGAATCTAAGTTTTGTTTCGGCTTAATCGTAGATAATTGCTTTAAGTGCTTCGGCG
AACAAACTATCAAAGATTAAGGAAAATGTAGATGAATATGCTGCCTTGATCATGGAAGAACTCGATCGCAACAACCTCGGATATATTGAG
GTTCGTTGTCTACTATCTAATGGTTACACT
TGTTTAACATCATTATAAAAAAGACAGGTTTAAATCCTTATAATCAATTAAATGTTTTTGTTATTTCAATGTGTTCACAAATATAGTTGAGCAATGGTTTATTTGCAGCTACACAACTTG
GAAACATTGCTTCTCCAAGTTCCAAGCCAATCAAACAACAGTCCATCTTCCGCGAACAAACGTGCACTCAACAAGATGTTGAGTCAGAAGCTGATACCAACGAAAGATCGGAACCCGGTG
AAAAGATTTGCTAGGAATATTTCATACTACTTCTTGGAAAATTGGAAAAGGATTTGGGTGTTAACATTGTGGATATCCATTTGCATCGCTCTCTTCACTTGGAAATTTCTCCAGTATAAA
CGCAAAACCGTATTCGAGGTGTTGGGCTACTGTGTTTCAGTGGCCAAAGGCAGTGGAGACCTTGAAATTCAACATGGCTCTCATCCTCTTGCCCGTTTGTAGGAACACTATAACTTGGCT
AAGGACCAAGTCAAAGCTTATTGGGTCCGTTGTTCCATTTGATGACAACATCAATTTCCACAAG
GTAAATTATTATGCATATTAATATCATATCTATACACATTATATAATTTTCATTAG
CCAATAAATATCGGTGTATTTTTTTTATAGAAGAATACAAAAAGGCATACGATTGTGGTAAAAATTTGGTTATGCTTAATCTTTATTTCCATGCAGGTTATTGCGTTTGGGATCGCAATT
GGAACTGGCTTACACGCCATATCTCACCTGGCATGCGATTTCCCGCGTTTGTTGCATGCAAAAAATGTAGAATATGAGCCAGTAAAAAGGTTTTTCGGAGACGAGAGGCCGGACAATTAC
GGATGGTTCATGAAAGGGACAGATGGTTGGACCGGAGTCACCATGGTGGTTCTAATGGTAGTGGCCTACGTCTTGGCGCAGTCTTGGTTCAGACGCAACCGGGCAAACCTACCAAAATCG
TTGAAACGATTGACGGGTTTCAACGCGTTTTGGTACTCGCACCATTTGTTTGTCATCGTTTATGTGCTTCTAATCGTGCATGGCTATTTTATCTATCTCTCCAAGGAATGGTACCACAAG
ACG
GTACGTATATATACATATATCCTTTCTTGCGTCTTAATTAATCATGGAAATTTTCAGAAAATTAGAAAGATCATAATAGTTTTTTTGATGAAAGTATCGTTTGTTATTATTACGTAC
ATTTGACAGACGTGGATGTATCTGGCTGTTTCCGTTCTACTATATGCATCTGAACGATTGATTCGTGCATTTAGACCAGGTGCCAAGGCTGTCAAGATTTTAAAGGTGTTTCTACAATCT
GTTTTGGACATCGCAACTCAAATCCTTATTTTCCAAGGTTACTAGTTTTCAAGAGTAATAACATTTATGAATTGATGATATATACGTGATTAGTTAGCTTTATAATTTGTTTTAATTACA
AAACCATAGGTTTGTCAACTTCCCTCGACAAGTCAAAGTGGGCTCTTCATAGCTGACATAGGTCAAGCCAACAATATAACTAGGTACAGTATTTGGTATATATAATCATGTTTTAAAAAC
ATGAGCATACAAATTTTTCTAATGAATTTTACATGGAAAGGTTTCCGAGGCTGTTAATCGATGGTCCATATGGAGCACCAGCACAAGATTACCGGCACTACGATGTATTGCTTCTGGTAG
GTCTAGGGATCGGAGCGACGCCATTAATCAGCATAATCAGGGACGTCCTTAACAACATCAAGAACCAGAAATCGATCGAACAAGGCACTAACCAACACATAAAAAACTATGTTGCCACAA
AACGAGCTTATTTCTATTGGGTAACAAGAGAGCAAGGATCATTGGAATGGTTCAGTGAGGTCATGAACGAGGTAGCTGAGTACGATAGCGAGGGGATGATTGAACTACATAATTACTGTA
CGAGCGTGTATGAGGAAGGAGACGCGAGGTCAGCACTAATCACAATGTTGCAGTCATTGCACCATGCCAAGAGCGGCATTGACATCGTATCGGGCACGCGGGTCCGAACCCATTTCGCTC
GTCCCGATTGGCGTAGCGTCTTCAAGCACGTTGCTGTCAACCACGTCAATCAACGAGTTG
GTATGTCATTATCACAACGATTACATAGCTATTGTAGAATCTTTCTAGTAACTGATTTTA
CTTTTTCTATTTTGTTGGTAGGGGTTTTCTACTGTGGTAATACATGCATCATAGGAGAGTTAAAGAGACTAGCTCAAGATTTCTCTAGGAAAACTACGACCAAGTTTGAGTTCCACAAGG
AGAATTTT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAATCTTGGTCAGAAGAAGAGAAAATCAAGATTTCCCGATGCAAAGCCACTGGTCCAGAAAATTCTGAAGAGGACGACGTCGAGATCACACTCGAAGTGCGAGACGAAAGCATCAGC
ACAACGAAGGCCAAGGCGACACTTCGGTCTGTTCTTTCCGGGAGACTAAAAACGATGGTGAAGACGTTGTCGTTTGCTTCACGCCGGCTCGACCGTAGTAAGTAATCCGGTGCTATGTTT
GCTCTTCGAGGTTTGAGGTTCATTGCCAAAACCGACGCCGTTGGCAGAGGCTGGGATGAGGTTGCAACGAGGTTCGATCAGTTGGCCGTTGAAGGGAAGCTCCCTAAATCCAAATTTGGA
CATTGCATAG
GAATGGTTGAATCTAGCGAATTTGTGAACGAGCTTTTTGAGACGTTGGTCCGAAGGAGAGGGACTTCGTCATCGTCAATCACCAAAACTGAATTGTTTGAATTTTGGGAG
CAGATCACAGGCAATAGCTTTGATGCTAGACTGCAAATCTTTTTTGATATG
GTGGACAAAAATTTGGACGGACGTATTACTGGAGATGAGGTTAAGGAGATAATTGCTTTAAGTGCTTCG
GCGAACAAACTATCAAAGATTAAGGAAAATGTAGATGAATATGCTGCCTTGATCATGGAAGAACTCGATCGCAACAACCTCGGATATATTGAG
CTACACAACTTGGAAACATTGCTTCTC
CAAGTTCCAAGCCAATCAAACAACAGTCCATCTTCCGCGAACAAACGTGCACTCAACAAGATGTTGAGTCAGAAGCTGATACCAACGAAAGATCGGAACCCGGTGAAAAGATTTGCTAGG
AATATTTCATACTACTTCTTGGAAAATTGGAAAAGGATTTGGGTGTTAACATTGTGGATATCCATTTGCATCGCTCTCTTCACTTGGAAATTTCTCCAGTATAAACGCAAAACCGTATTC
GAGGTGTTGGGCTACTGTGTTTCAGTGGCCAAAGGCAGTGGAGACCTTGAAATTCAACATGGCTCTCATCCTCTTGCCCGTTTGTAGGAACACTATAACTTGGCTAAGGACCAAGTCAAA
GCTTATTGGGTCCGTTGTTCCATTTGATGACAACATCAATTTCCACAAG
GTTATTGCGTTTGGGATCGCAATTGGAACTGGCTTACACGCCATATCTCACCTGGCATGCGATTTCCCGCG
TTTGTTGCATGCAAAAAATGTAGAATATGAGCCAGTAAAAAGGTTTTTCGGAGACGAGAGGCCGGACAATTACGGATGGTTCATGAAAGGGACAGATGGTTGGACCGGAGTCACCATGGT
GGTTCTAATGGTAGTGGCCTACGTCTTGGCGCAGTCTTGGTTCAGACGCAACCGGGCAAACCTACCAAAATCGTTGAAACGATTGACGGGTTTCAACGCGTTTTGGTACTCGCACCATTT
GTTTGTCATCGTTTATGTGCTTCTAATCGTGCATGGCTATTTTATCTATCTCTCCAAGGAATGGTACCACAAGACG
ACGTGGATGTATCTGGCTGTTTCCGTTCTACTATATGCATCTGA
ACGATTGATTCGTGCATTTAGACCAGGTGCCAAGGCTGTCAAGATTTTAAAGGTG
TGGACATCGCAACTCAAATCCTTATTTTCCAAGGTTTGTCAACTTCCCTCGACAAGTCAAAGTGG
GCTCTTCATAGCTGACATAGGTCAAGCCAACAATATAACTAG
GTTTCCGAGGCTGTTAATCGATGGTCCATATGGAGCACCAGCACAAGATTACCGGCACTACGATGTATTGCTTCTGGT
AGGTCTAGGGATCGGAGCGACGCCATTAATCAGCATAATCAGGGACGTCCTTAACAACATCAAGAACCAGAAATCGATCGAACAAGGCACTAACCAACACATAAAAAACTATGTTGCCAC
AAAACGAGCTTATTTCTATTGGGTAACAAGAGAGCAAGGATCATTGGAATGGTTCAGTGAGGTCATGAACGAGGTAGCTGAGTACGATAGCGAGGGGATGATTGAACTACATAATTACTG
TACGAGCGTGTATGAGGAAGGAGACGCGAGGTCAGCACTAATCACAATGTTGCAGTCATTGCACCATGCCAAGAGCGGCATTGACATCGTATCGGGCACGCGGGTCCGAACCCATTTCGC
TCGTCCCGATTGGCGTAGCGTCTTCAAGCACGTTGCTGTCAACCACGTCAATCAACGAGTTG
GGGTTTTCTACTGTGGTAATACATGCATCATAGGAGAGTTAAAGAGACTAGCTCAAGA
TTTCTCTAGGAAAACTACGACCAAGTTTGAGTTCCACAAGGAGAATTTT

Retrieve as FASTA