Entry information : AlyRboh[P]G
Entry ID 7586
Creation 2010-08-11 (Christophe Dunand)
Last sequence changes 2010-08-11 (Christophe Dunand)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2011-01-28 (Christophe Dunand)
Peroxidase information: AlyRboh[P]G
Name AlyRboh[P]G
Class Respiratory burst oxidase homolog     [Orthogroup: Rboh001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis lyrata    [TaxId: 59689 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AlyRboh[P]G
start..stop
S start..stop
AlyRboh07 1124 0 1..647 215..860
AtRboh07 1121 0 1..647 204..849
AlyRboh03 1047 0 1..647 255..906
AtRboh03 1044 0 1..647 254..905
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6723719..6723832 114 N° 2 6723203..6723580 378 N° 3 6722601..6722995 395 N° 4 6722307..6722518 212
N° 5 6722113..6722218 106 N° 6 6721607..6721756 150 N° 7 6721234..6721579 346 N° 8 6720713..6720822 110
complement(join(6720713..6720822,6721234..6721579,6721607..6721756,6722113..6722 218,6722307..6722518,6722601..6722995,6723203..6723580,6723719..6723832))


exon

Literature and cross-references AlyRboh[P]G
DNA ref. Phytozome 11:   scaffold_8 (6723832..6720713)
Protein sequence: AlyRboh[P]G
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   647
PWM (Da):   %s   73913.29 Transmb domain:   %s   o96-118i238-260o284-306i459-476o
PI (pH):   %s   9.46
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
IISLSSSANHLSTIKTNADGYAAMIMKVLDKDNIGYIMNSEERKKLGDMISNKLKPTLDPNPLKRWYHKLRFFVLDNWQRIWVIVLWLMIMAILFIYKYIQYKNREVYEVLGHCVCLAKGAAETLKLNMALILLPVCRNTITWLRTKTSLGVIVPFDDNLNFHQVIAVGIMIGVAIHSVTHLACDFPRLIAATPEEYMPLRKFFGEEQPKRYLHFVKSTEGITGLIMVFLMAIAFTLAIPWFRRGKLEKKLPEPLKKLASFNAFWYILTICS**YTFSLSFTDTTCISAKNGTRKRRGCTWQYQ*LSMHVRD*YEHLGPKWRR*KLLRLRLILETY*HCTCQGLQTSNTRAVNTCL*TVQQSHRLGIHFQ*LLHHMTSI*VFI*NHLEIGQRLSKEFSPRSSREL*LMVRTAHQHKTTRNTRWFC*SALGLEPPQ**VLLRT*SIIRRPKKDHNMSHKVKKKLSRREGLTSTG*QGSKAHMIGSRTS*TRLLSGTKIKS*NYTTIALASMKKETFVQRSYICFSL*TMPRVV*TLSLGPRLCPTLPNLIGKTFTNR*PWITLALMECFIVEPRH*QRS*GI*LWNSHIRQELDSPSTKKTX

Retrieve as FASTA  
Remarks Partial sequence from genomic (chromo 8). Undetermined sequence downstream.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATCATTAGTCTTAGTTCGTCTGCCAACCATCTTTCAACCATAAAGACAAATGCAGATGGATATGCAGCAATGATAATGAAAGTGCTTGACAAAGATAATATTGGATACATCATGGTAAGT
TTTCTTGAAGATAACCCGAGGATCGATAATTTTTCGATTACTACTTGTGTTTGTAACTTTGTGGTGAATTTAAAACAGATGGGTAGTCTTAAATCCTTGCTTCTGGAAGCTGAAACACAT
TCCATCAGCACAAACAGTGAAGAAAGAAAGAAGTTGGGCGACATGATAAGTAACAAGCTTAAGCCTACACTTGACCCTAACCCGTTGAAGAGATGGTACCATAAACTTAGATTCTTCGTA
CTGGATAACTGGCAAAGAATTTGGGTAATAGTGCTATGGCTCATGATTATGGCCATCCTCTTCATATACAAATATATTCAATACAAGAATAGAGAAGTGTATGAAGTGTTGGGGCATTGT
GTGTGCTTGGCTAAAGGTGCAGCTGAGACACTGAAGCTGAACATGGCCTTGATTCTGTTACCTGTATGCAGAAATACCATTACATGGCTTAGAACTAAAACTAGTTTGGGTGTTATTGTC
CCTTTTGATGACAACCTCAACTTTCATCAG
GTAAAACCACATTTGATTTTGTTATTTTCAACCATCTATGGTAGATATAAACGTTTTAAATGAAAAGAAACATAGTTTGTACGTGCTTTA
AAATTACTCTGAACTGTCCTTACCTAGTTATAAGAAAACACTCTTTTTTAATAAAATTGCAAAAATATCTCTCATTCTTATTATGATATATAGCAAAATTGATGGCCAAACCTACAGGTT
ATAGCGGTGGGAATCATGATAGGAGTAGCCATACACTCGGTGACCCACTTGGCGTGCGATTTTCCACGGCTAATTGCGGCAACTCCAGAGGAATACATGCCTCTACGAAAATTCTTTGGA
GAAGAGCAACCAAAGAGATACTTGCATTTTGTGAAGTCAACAGAAGGAATAACAGGACTCATAATGGTTTTCTTGATGGCAATTGCTTTTACACTAGCTATCCCTTGGTTTAGACGAGGG
AAGCTCGAAAAAAAGCTTCCAGAGCCACTAAAGAAACTAGCTAGCTTCAATGCCTTCTGGTATATACTCACCATTTGTTCGTGATAGTATACATTCTCCTTGTCCTTCACGGATACAACT
TGTATCTCAGCAAAGAATGGTACAAGAAAACG
GTAAGTAGTTCGATATTCAACATTTTCAATCGTATAATCTTCGCGTTTAGAAATGTAACAAACTTGCTTATTTTGTTTGTAAACGTGG
ATGTACTTGGCAGTACCAGTAGCTTTCTATGCATGTGAGAGATTAATACGAGCATTTAGGTCCAAAATGGAGACGGTAAAAGTTATTAAGGCTGCGACTTATCCTGGAAACGTATTGACA
TTGCACATGTCAAGGCCTACAAACTTCGAATACAAGAGCGGTCAATACATGTTTGTAAACTGTCCAGCAGTCTCACCGTTTGAGTG
GTATGCAAAAATCACTCTTTAAGAGACAACAACT
CTAAACTCATCTCAATATCATCTCACGTGATTATATATATATATATAACTACATGCATCCATTTTCAATAACTTCTGCACCACATGACGAGTATTTAAGTGTTCATATAAAATCACTTGG
AGATTGGACAAAGGCTATCAAAGGAGTTTTCTCCGAGGTC
TTTTTTACTTCTAAATCTCTCAAAATTTTAAGAAATATTATAAGTCTTGAAGTCGGGGAAAGATAGTTAATTTGAGAAAG
ATTTTGTGTTATATCTCAGGTATCTATGCCACTTCCGGTCGGAGAGATGTCGCATGGTGCAAATAATTCCGAGTAAGTTTTTTATTTTTTTGGGCAAAATAATTCCGAGTAAATATATTC
ACAAATTTGACACAAAAACCAACAGTAAGTATAAACAAAAATTTGAAAAATCGCTAAAAGTATACATATACCATTATGTTTTCTTGGACTATTATTCTACCTAAGAAAACTTAGTGTTTT
TTATTTTGTTATGGCAATGACCCCTCCTTCCACAGTTTCCCGAGAATTATGATTGATGGTCCGTACGGCGCACCAGCACAAGACTACAAGAAATACGAGGTGGTTCTGCTGATCGGCCTT
GGGATTGGAGCCACCCCAATGATAAGTATTATTAAGGACATAATCAATAATACGGAGACCAAAGAA
CTTTCTCAAGTTGACCTAGGGAAGGTGGGATCACAACATGAGCCACAAGGTGAA
AAAGAAACTTTCAAGACGCGAAGGGCTTACTTCTACTGGGTAACAAGGGAGCAAGGCTCATATGATTGGTTCAAGAACATCATGAACGAGATTGCTGAGCGGGACAAAAATAAAGTCATA
GAACTACACAACTATTGCACTAGCGTCTATGAAGAAGGAGACGTTCGTTCAGCGTTCATACATATGCTTCAGTCTCTAAACCATGCCAAGAGTGGTTTAGACATTGTCTCTGGGACCAAG
GTTATGTCCTACTTTGCCAAACCTAATTGGGAAAACATTTACAAACAGATAGCCATGGATCACCCTGGCTCTAATGTTG
GTAAGCTCTCTCACTTTCCCTCATACATGGTTGGTTAATTT
GGTTCTCTTGTAACAAGATTTAATTTTGATGCATTTTTAAAGACATGCTTGCATCGACTTGCAAGAAATTCTCAATGGCATATCGCACTATCGACTCATATCATGCAAAGATTAGCTTAG
GCTCATGCTTTTTTTTTCGGTCTTGCATTATGCGGTAACCCGGTAGTGTCGTACACAGACACTAGCAAAAACTATTATACTACATGTCTTAGTAAACTTTATGAGTTTCACATGTTCAAA
GTCATTGGTGCATGTTATAGTAACTATGCTCTAGAATATTTTTTTGGTATTATAAAATATCATTGTGTGATTATGATTAATTACTATAAAAAAAAAAAAGAGAATGATACAAGTTGACAT
AAACGTGCAGGAGTGTTTTATTGTGGAGCCCCGGCATTGACAAAGGAGTTAAGGAATTTAGCTTTGGAATTCGCACATAAGACAAGAACTAGATTCTCCTTCCACAAAGAAAACTTTTAA

Retrieve as FASTA