Entry information : Ab2CysPrx_bisporus
Entry ID 7588
Creation 2010-08-16 (Christophe Dunand)
Last sequence changes 2010-08-16 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-04-10 (Christophe Dunand)
Peroxidase information: Ab2CysPrx_bisporus
Name Ab2CysPrx_bisporus
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Agaricaceae Agaricus
Organism Agaricus bisporus    [TaxId: 5341 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Ab2CysPrx_bisporus
start..stop
S start..stop
Lbi2CysPrx 341 3e-121 1..214 1..219
Athi2CysPrx01 333 5e-118 1..214 1..217
Ccin2CysPrx 331 2e-117 1..214 1..211
Sbre2CysPrx01 327 2e-115 1..212 1..213
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 574370..574470 101 N° 2 574284..574307 24 N° 3 574209..574232 24 N° 4 574091..574152 62
N° 5 573828..574026 199 N° 6 573683..573761 79 N° 7 573467..573622 156  
complement(join(573467..573622,573683..573761,573828..574026,574091..574152,5742 09..574232,574284..574307,574370..574470))


exon

Literature and cross-references Ab2CysPrx_bisporus
DNA ref. JGI genome:   scaffold_13 (574470..573467)
Protein sequence: Ab2CysPrx_bisporus
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   214
PWM (Da):   %s   23480  
PI (pH):   %s   6.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVALVQRPAPPFNADAVVNGSFQEISLSSLLGQWVVMLFYPMDFTFVCPTEILAFNDALSQFKALNTTVGVSTDSKFSHHAWASQSRKEGGLGPDLVLPLLADRNMHISREYGVLLEDEGIALRGLFIIDPKGTVRQITVNDLPVGRSVDETLRLIKAFQFDQFGEVCPANWQEGAKTIKPNPSEKLEYFSASNANGHNGHNGHPNKRARKD*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 13, 6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTGCTCTCGTTCAACGCCCAGCTCCTCCTTTCAACGCAGACGCCGTAGTGAATGGCTCGTTCCAAGAAATATCCTTGTCCAGCCTGCTCGGTCAATGGTAAAATCGCGAGTCGGTA
TTTTTCAAACTCAATTGAAATTTGATGTTGTATCTTTTTGCAGGGTTGTTATGCTGTTCTATCCCATGTATGTTGAATTTTATGCCTCATTATTGCTCTGTTGATGAATATCTGTTAGGG
ACTTCACCTTTGTGTGTCCAAC
GTAAGCATGTATCCGCTACAAATTTTTCGTGTCAAGTCCTCATAACAAGAAAATAGTGAGATTCTTGCTTTCAACGATGCGCTTTCTCAGTTCAAAGC
CTTGAACACGACAGTACTCG
GTAAGCACTCTCCTCTTCAAATTAATTCCTCCATTTTCTCAAGCAGAAAAAACCACATTTCAAGGGGTCTCTACGGATTCGAAGTTTTCCCATCACGCTT
GGGCTTCGCAATCTCGCAAGGAGGGTGGACTTGGTCCTGACCTCGTGCTTCCTCTTCTCGCCGACAGAAACATGCACATATCTCGCGAATATGGTGTTTTGTTGGAGGATGAAGGTATCG
CCCTTCGTGGTCTCTTCATCATTGACCCCAAGGGTACCGTGAG
GTGAGTGTCGCGTCGCGAACATTTATATTTAGAATATTCATCAAAGTATAATTTTTTGATGTTCAGGCAAATCACTG
TCAATGATCTTCCCGTTGGACGTTCCGTTGATGAAACCCTCCGACTGATCAAAGCATTTCAATTCACC
GTCAGTTATTTCTTCATCTTTCATTCTTTTACTGCTGGCTGAGAAGACATTT
TTGAACAGGATCAATTCGGTGAGGTTTGCCCTGCAAATTGGCAAGAGGGCGCCAAGACCATCAAACCGAACCCATCCGAGAAGCTTGAATACTTCTCCGCTTCCAATGCCAATGGACACA
ACGGACACAATGGACACCCTAACAAGCGTGCACGTAAGGACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTGCTCTCGTTCAACGCCCAGCTCCTCCTTTCAACGCAGACGCCGTAGTGAATGGCTCGTTCCAAGAAATATCCTTGTCCAGCCTGCTCGGTCAATGGGTTGTTATGCTGTTCTAT
CCCAT
GGACTTCACCTTTGTGTGTCCAACTGAGATTCTTGCTTTCAACGATGCGCTTTCTCAGTTCAAAGCCTTGAACACGACAGTACTCGGGGTCTCTACGGATTCGAAGTTTTCCCAT
CACGCTTGGGCTTCGCAATCTCGCAAGGAGGGTGGACTTGGTCCTGACCTCGTGCTTCCTCTTCTCGCCGACAGAAACATGCACATATCTCGCGAATATGGTGTTTTGTTGGAGGATGAA
GGTATCGCCCTTCGTGGTCTCTTCATCATTGACCCCAAGGGTACCGTGAG
GCAAATCACTGTCAATGATCTTCCCGTTGGACGTTCCGTTGATGAAACCCTCCGACTGATCAAAGCATTT
CAATTCACC
GATCAATTCGGTGAGGTTTGCCCTGCAAATTGGCAAGAGGGCGCCAAGACCATCAAACCGAACCCATCCGAGAAGCTTGAATACTTCTCCGCTTCCAATGCCAATGGACAC
AACGGACACAATGGACACCCTAACAAGCGTGCACGTAAGGACTGA

Retrieve as FASTA