Entry information : AbCcP_bisporus
Entry ID 7589
Creation 2010-08-16 (Christophe Dunand)
Last sequence changes 2010-08-16 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: AbCcP_bisporus
Name AbCcP_bisporus
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Agaricaceae Agaricus
Organism Agaricus bisporus    [TaxId: 5341 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AbCcP_bisporus
start..stop
S start..stop
AthiCcP01 581 0 5..378 1..370
MfiaCcP01 574 0 4..378 2..378
PoCcP_PC9 571 0 6..378 4..372
PoCcP_PC15 566 0 6..371 4..365
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 460091..460405 315 N° 2 459993..460041 49 N° 3 459844..459925 82 N° 4 459638..459791 154
N° 5 459454..459587 134 N° 6 459327..459392 66 N° 7 459116..459265 150 N° 8 458974..459057 84
N° 9 458810..458915 106  
complement(join(458810..458915,458974..459057,459116..459265,459327..459392,4594 54..459587,459638..459791,459844..459925,459993..460041,460091..460405))


exon

Literature and cross-references AbCcP_bisporus
DNA ref. JGI genome:   scaffold_16 (460405..458810)
Cluster/Prediction ref. JGI gene:   229666
Protein sequence: AbCcP_bisporus
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   379
PWM (Da):   %s   42258.21  
PI (pH):   %s   8.86
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTTMSFLRRAQPLRRVAFSPSLAQRVSRSHPNVRRFTTEPPPPPPPPPKSNTALYAGIGAAAVGGLALYFFTDFGKKADTAAKSAVQTTKSATGFVPGKEDYQKVYNRIAEIIDDAGDYDDGSYGPVVLRLAWHSSGTYDKDTKTGGSNYATMRFEPESNHGANAGLNVARNLMEKVKAEFPWISYGDLWTLAGVCAIEMAGPKIPWRPGRIDGFAAQATPDGRLPDAKLGADHLRTIFYRMGFNDREIVALSGAHALGSCHRDRSGFDGPWTFSPTTVTNDFYKLLLEEKWIWRKWDGPKQLQDKTTQSLMMLPTDYVLTQDKSFKKWTKAYADDQELWFKDFSDVVSRLFELGVPTQQFVTSEPWIMKNVDEQKK

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 16).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTACCACCATGTCCTTCCTTCGTCGTGCTCAACCTCTTCGCAGAGTTGCTTTTTCTCCTAGTCTCGCGCAGAGGGTCTCCAGGTCTCACCCCAACGTCCGTCGCTTCACTACTGAA
CCTCCCCCTCCCCCGCCTCCTCCCCCAAAGTCGAATACCGCTCTCTACGCCGGTATCGGTGCTGCCGCTGTTGGTGGCCTAGCCCTCTACTTTTTCACCGACTTTGGCAAAAAGGCCGAC
ACTGCCGCCAAGTCCGCTGTTCAGACCACTAAATCCGCGACCGGCTTTGTGCCTGGAAAGGAGGACTACCAAAAG
GTTCGCATTTTGACAAGCTTTTTTTCATCCAAATCTCATTGGCGG
CTAGGTCTACAACAGGATTGCTGAAATCATCGACGATGCTGGTGACTATGATGGTAGGGCCCAAAAAACTCACATATTTCTTATCGAGCTTCTTGGCTGATGGATAATCACCCACTACAG

ATGGTTCCTATGGTCCCGTTGTCCTCCGACTGGCCTGGCACTCTTCCGGCACATATGATAAGGACACGAAGACTGGGGGAAG
GTGAGCATCTTTGCGCTCTTTATTAATTATTTACGGAG
CGTTTTAAATCCAGCAATTACGCCACTATGCGTTTTGAGCCCGAGTCAAATCATGGAGCCAATGCCGGTTTAAATGTAGCTCGCAACCTCATGGAAAAGGTCAAGGCAGAATTTCCCTGG
ATCAGCTACGGTGACCTTTGGACTCTTGCCGGTGTTTGTGCCATCCAG
GTAAGTGGCCCCTATTCCAACTCAGTTTGTGGGTGCTCAGATCTTGGTAGGAAATGGCTGGTCCGAAGATCC
CCTGGCGTCCGGGTCGTATTGATGGTTTCGCCGCGCAAGCCACTCCAGATGGCCGTTTACCAGATGCTAAGTTGGGCGCTGACCATTTAAGAACAATCTTTTACCGCATGGG
GTATGTTG
ATATATTAGCCGATGGTCCGGCAATTGAATCCAGGGCTGACGTTATCTCTCAGCTTTAATGACCGTGAAATCGTTGCGTTATCAGGCGCTCATGCCTTAGGCAGCTGCCACCGCGATCGG
TAAGTTCTCGATAAGCAAACCCATGCAACGGTCGCCGAGACTCACCTGATGGTTGAATAGTTCTGGTTTTGATGGTCCATGGACTTTCTCTCCTACCACGGTGACCAACGATTTTTACAA
GTTGCTCCTCGAGGAGAAATGGATCTGGAGAAAGTGGGATGGACCTAAGCAACTTCAGGACAAGACGACGCAGTCTTTGATGATGTTACC
GTATGTTGAAATGTCATGATAAAGTGTTCT
ATTCTTAGTCACTGATGACCCTTACCAGTACCGACTATGTCCTTACCCAAGATAAGAGCTTCAAGAAATGGACCAAGGCTTATGCTGATGATCAAGAACTCTGGTTCAAGGAGTACGCTC
TGATTGCCATCATTCACGCTTTTTTACCGTTTCTAACCATCAATCTCTAGCTTCTCGGACGTGGTATCTCGTCTTTTCGAGTTGGGTGTTCCTACTCAACAATTTGTTACCTCGGAGCCT
TGGATCATGAAGAACGTTGACGAGCAGAAGAAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTACCACCATGTCCTTCCTTCGTCGTGCTCAACCTCTTCGCAGAGTTGCTTTTTCTCCTAGTCTCGCGCAGAGGGTCTCCAGGTCTCACCCCAACGTCCGTCGCTTCACTACTGAA
CCTCCCCCTCCCCCGCCTCCTCCCCCAAAGTCGAATACCGCTCTCTACGCCGGTATCGGTGCTGCCGCTGTTGGTGGCCTAGCCCTCTACTTTTTCACCGACTTTGGCAAAAAGGCCGAC
ACTGCCGCCAAGTCCGCTGTTCAGACCACTAAATCCGCGACCGGCTTTGTGCCTGGAAAGGAGGACTACCAAAAG
GTCTACAACAGGATTGCTGAAATCATCGACGATGCTGGTGACTAT
GATG
ATGGTTCCTATGGTCCCGTTGTCCTCCGACTGGCCTGGCACTCTTCCGGCACATATGATAAGGACACGAAGACTGGGGGAAGCAATTACGCCACTATGCGTTTTGAGCCCGAGTCA
AATCATGGAGCCAATGCCGGTTTAAATGTAGCTCGCAACCTCATGGAAAAGGTCAAGGCAGAATTTCCCTGGATCAGCTACGGTGACCTTTGGACTCTTGCCGGTGTTTGTGCCATCCAG
GAAATGGCTGGTCCGAAGATCCCCTGGCGTCCGGGTCGTATTGATGGTTTCGCCGCGCAAGCCACTCCAGATGGCCGTTTACCAGATGCTAAGTTGGGCGCTGACCATTTAAGAACAATC
TTTTACCGCATGGG
CTTTAATGACCGTGAAATCGTTGCGTTATCAGGCGCTCATGCCTTAGGCAGCTGCCACCGCGATCGTTCTGGTTTTGATGGTCCATGGACTTTCTCTCCTACCACG
GTGACCAACGATTTTTACAAGTTGCTCCTCGAGGAGAAATGGATCTGGAGAAAGTGGGATGGACCTAAGCAACTTCAGGACAAGACGACGCAGTCTTTGATGATGTTACC
TACCGACTAT
GTCCTTACCCAAGATAAGAGCTTCAAGAAATGGACCAAGGCTTATGCTGATGATCAAGAACTCTGGTTCAAGGA
CTTCTCGGACGTGGTATCTCGTCTTTTCGAGTTGGGTGTTCCTACT
CAACAATTTGTTACCTCGGAGCCTTGGATCATGAAGAACGTTGACGAGCAGAAGAAGTGA

Retrieve as FASTA