Entry information : AbGPx_bisporus
Entry ID 7594
Creation 2010-08-17 (Christophe Dunand)
Last sequence changes 2010-08-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-10 (Christophe Dunand)
Peroxidase information: AbGPx_bisporus
Name AbGPx_bisporus
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Agaricaceae Agaricus
Organism Agaricus bisporus    [TaxId: 5341 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AbGPx_bisporus
start..stop
S start..stop
HcyGPx01 265 5e-92 2..159 51..208
HsubGPx01 262 4e-91 2..159 53..210
AmusGPx01 260 7e-91 1..159 8..166
GmarGPx02 260 3e-90 2..159 56..213
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1213868..1213974 107 N° 2 1214035..1214057 23 N° 3 1214112..1214179 68 N° 4 1214249..1214422 174
N° 5 1214494..1214601 108  
join(1213868..1213974,1214035..1214057,1214112..1214179,1214249..1214422,1214494 ..1214601)


exon

Literature and cross-references AbGPx_bisporus
DNA ref. JGI genome:   scaffold_3 (1213868..1214601)
Protein sequence: AbGPx_bisporus
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   159
PWM (Da):   %s   17734.08  
PI (pH):   %s   8.03
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSGFYSLKAELPNGDVFDFADLKGKTVLIVNIASKCGFTPQHGLQALDEKYKDKGLVILGFPCNFGSQEPGSDEQIKEFCTVNYGVNFQLMKKSNVNGDETNEVYKWLKSEKPGLLGLTRIKWNFEKFLVDKNGKVVNRWASTTTPSSLEPEIEKIL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGGGATTCTACTCTCTGAAAGCCGAGCTACCTAATGGCGACGTGTTTGACTTCGCAGACCTCAAAGGAAAGACAGTCCTCATCGTCAACATTGCTTCGAAGTGGTATGTTGCGCTC
TTCTGTATGCCTCGTCCCTTCGACTCACGGGGAAATTACGTAACCAGCGGATTCACTCCCCAACATAAAGGTTCCATCCCTTCTCCCATATATCTTCGGGACTTGCTCTGAAGATATCAT
ACAGGTCTTCAGGCTCTCGATGAAAAATACAAGGATAAGGGACTAGTCATATTGGGGTTCCCATGCAATCAAGTACGCAAAGGCGGTCTCTTGCTGCGATAGATTCATGCATGTATCAGT
AACTTACCTCATATTTTATAGTTTGGTTCTCAAGAGCCGGGATCCGACGAACAAATCAAGGAGTTTTGTACTGTTAATTATGGCGTCAATTTCCAACTTATGAAGAAGTCAAACGTAAAC
GGGGATGAGACCAACGAAGTTTACAAATGGCTCAAGTCTGAGAAGCCAGGACTCCTGGGGCTAACCCGCATCAAG
GTATGTCTGTTAATACTTGGCACCAGCCTTTGTATCTCGACTCGG
ACTGACCATTTCGACAACTCCACTAGTGGAATTTTGAGAAGTTCCTTGTGGACAAGAATGGTAAAGTAGTCAACCGCTGGGCCTCAACAACCACCCCAAGCTCTCTTGAACCCGAAATTG
AGAAGATCTTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGGGATTCTACTCTCTGAAAGCCGAGCTACCTAATGGCGACGTGTTTGACTTCGCAGACCTCAAAGGAAAGACAGTCCTCATCGTCAACATTGCTTCGAAGTGCGGATTCACTCCC
CAACATAAAG
GTCTTCAGGCTCTCGATGAAAAATACAAGGATAAGGGACTAGTCATATTGGGGTTCCCATGCAATCAATTTGGTTCTCAAGAGCCGGGATCCGACGAACAAATCAAGGAG
TTTTGTACTGTTAATTATGGCGTCAATTTCCAACTTATGAAGAAGTCAAACGTAAACGGGGATGAGACCAACGAAGTTTACAAATGGCTCAAGTCTGAGAAGCCAGGACTCCTGGGGCTA
ACCCGCATCAAG
TGGAATTTTGAGAAGTTCCTTGTGGACAAGAATGGTAAAGTAGTCAACCGCTGGGCCTCAACAACCACCCCAAGCTCTCTTGAACCCGAAATTGAGAAGATCTTGTGA

Retrieve as FASTA