Entry information : CcinHCMDn[P]
Entry ID 7605
Creation 2010-08-17 (Christophe Dunand)
Last sequence changes 2010-08-17 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2010-08-17 (Christophe Dunand)
Peroxidase information: CcinHCMDn[P]
Name CcinHCMDn[P]
Class Hydrolase-CMD fusion (no peroxidase activity)    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Psathyrellaceae Coprinopsis
Organism Coprinopsis cinerea (Coprinus cinereus)    [TaxId: 5346 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CcinHCMDn[P]
start..stop
S start..stop
CcinHCMDn 575 0 1..344 210..552
LbiHCMDn 187 8e-55 30..343 265..568
UmHCMDn 153 8e-43 30..342 252..501
DgHCMDn 48 0.000001 140..342 90..258
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2135505..2135766 262 N° 2 2135781..2136546 766  
join(2135505..2135766,2135781..2136546)


exon

Literature and cross-references CcinHCMDn[P]
DNA ref. JGI genome:   Chr_8 (2135505..2136546)
Protein sequence: CcinHCMDn[P]
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   341
PWM (Da):   %s   36545.08  
PI (pH):   %s   7.01
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
EHSVTLPSFPKSKAAHQIYAVTLRHP*EDAPWIVLSNALLTSTKVWGWIVPYLLDENENFHASGEKPQPRYNILLHVQRGHGRSTLPNCPSDSVGYHDNDSARRSTIPLLARDVQNLLVRTRSRKSLSATRRS*SPFMQ*LASRRAGHVPWHLVPATPYRAEARTPPCARRKPSSHATPPLEHRLVIEMRGKRGSDLSSVEQDWTTLRASGCRVWPMSRSLDGSPLPRHSHPQGQRW*GRWSRRYLLKGSWNERGRWGRMICWRIGRGRSWMYRVGFLRARS*RFCSPLGAWMGTGRSGKG*RGWRISGAGLNTRLLKDQGIYPWSIARRCGVKWLVAGWVX

Retrieve as FASTA  
Remarks Pseudogene. Sequence from genomic (chromo 8). Several codon in frame and frame shift. 5'end is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAGCATAGCGTCACCCTACCTTCGTTCCCAAAGTCCAAAGCGGCTCACCAGATTTACGCTGTCACTTTGCGGCATCCATGAGAAGATGCGCCGTGGATCGTCCTTTCGAACGCTCTGCTC
ACGTCGACGAAGGTGTGGGGATGGATTGTTCCCTATTTGCTTGATGAAAATGAAAACTTCCATGCTTCCGGCGAGAAACCCCAACCCCGGTATAACATCCTCTTGCATGTTCAACGCGGT
CACGGGCGTTCTACTCTTCCAA
GTTCCACCCAATCCATTGTCCGAGCGACAGTGTTGGCTATCACGATAATGATTCAGCCCGACGCTCGACTATCCCACTCCTTGCTCGGGATGTACAGA
ATCTCCTCGTCCGGACGAGATCAAGAAAGTCATTGTCGGCGACTCGAAGGAGCTGAAGCCCATTCATGCAGTGATTGGCGTCTCGCAGGGCGGGGCATGTGCCCTGGCATTTGGTGCCAG
CTACCCCTTATCGAGCGGAAGCCCGGACACCACCGTGCGCAAGACGAAAGCCATCATCGCATGCGACACCTCCGCTCGAACACCGGCTGGTAATAGAGATGCGTGGAAAGAGAGGGTCGG
ACTTGTCCTCGGTGGAGCAGGATTGGACGACACTCAGAGCGTCGGGCTGTCGCGTCTGGCCGATGTCACGCTCCCTCGATGGTTCCCCCCTGCCTCGCCACTCACACCCTCAAGGGCAGC
GTTGGTGAGGAAGGTGGTCGAGGAGATACCTGTTGAAGGGTTCGTGGAATGAGCGAGGGCGTTGGGGTCGTATGATTTGTTGGAGGATTGGACGGGGGAGAAGCTGGATGTACCGGGTAG
GCTTTTTGAGGGCAAGGAGCTGAAGGTTTTGCTCGCCGCTGGGAGCTTGGATGGGAACGGGAAGGTCGGGGAAGGGTTGAAGGGGCTGGCGGATAAGTGGGGCCGGGCTTAATACAAGGC
TGTTGAAGGATCAGGGCATCTACCCATGGTCGATCGCCCGGAGGTGTGGTGTGAAGTGGTTGGTGGCTGGTTGGGTGGTCTC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAGCATAGCGTCACCCTACCTTCGTTCCCAAAGTCCAAAGCGGCTCACCAGATTTACGCTGTCACTTTGCGGCATCCATGAGAAGATGCGCCGTGGATCGTCCTTTCGAACGCTCTGCTC
ACGTCGACGAAGGTGTGGGGATGGATTGTTCCCTATTTGCTTGATGAAAATGAAAACTTCCATGCTTCCGGCGAGAAACCCCAACCCCGGTATAACATCCTCTTGCATGTTCAACGCGGT
CACGGGCGTTCTACTCTTCCAA
ATTGTCCGAGCGACAGTGTTGGCTATCACGATAATGATTCAGCCCGACGCTCGACTATCCCACTCCTTGCTCGGGATGTACAGAATCTCCTCGTCCGG
ACGAGATCAAGAAAGTCATTGTCGGCGACTCGAAGGAGCTGAAGCCCATTCATGCAGTGATTGGCGTCTCGCAGGGCGGGGCATGTGCCCTGGCATTTGGTGCCAGCTACCCCTTATCGA
GCGGAAGCCCGGACACCACCGTGCGCAAGACGAAAGCCATCATCGCATGCGACACCTCCGCTCGAACACCGGCTGGTAATAGAGATGCGTGGAAAGAGAGGGTCGGACTTGTCCTCGGTG
GAGCAGGATTGGACGACACTCAGAGCGTCGGGCTGTCGCGTCTGGCCGATGTCACGCTCCCTCGATGGTTCCCCCCTGCCTCGCCACTCACACCCTCAAGGGCAGCGTTGGTGAGGAAGG
TGGTCGAGGAGATACCTGTTGAAGGGTTCGTGGAATGAGCGAGGGCGTTGGGGTCGTATGATTTGTTGGAGGATTGGACGGGGGAGAAGCTGGATGTACCGGGTAGGCTTTTTGAGGGCA
AGGAGCTGAAGGTTTTGCTCGCCGCTGGGAGCTTGGATGGGAACGGGAAGGTCGGGGAAGGGTTGAAGGGGCTGGCGGATAAGTGGGGCCGGGCTTAATACAAGGCTGTTGAAGGATCAG
GGCATCTACCCATGGTCGATCGCCCGGAGGTGTGGTGTGAAGTGGTTGGTGGCTGGTTGGGTGGTCTC

Retrieve as FASTA