Entry information : AbPrxII_bisporus
Entry ID 7606
Creation 2010-08-17 (Christophe Dunand)
Last sequence changes 2010-08-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-10 (Christophe Dunand)
Peroxidase information: AbPrxII_bisporus
Name AbPrxII_bisporus
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Agaricaceae Agaricus
Organism Agaricus bisporus    [TaxId: 5341 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AbPrxII_bisporus
start..stop
S start..stop
SlutPrxII01 195 7e-65 10..180 4..172
LbiPrxII 194 2e-64 10..180 1..169
SbrePrxII01 194 4e-64 10..180 4..172
CcinPrxII 192 8e-64 11..180 4..171
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 858885..858989 105 N° 2 858804..858819 16 N° 3 858666..858739 74 N° 4 858429..858575 147
N° 5 858214..858354 141 N° 6 858065..858124 60  
complement(join(858065..858124,858214..858354,858429..858575,858666..858739,8588 04..858819,858885..858989))


exon

Literature and cross-references AbPrxII_bisporus
DNA ref. JGI genome:   scaffold_12 (858989..858065)
Cluster/Prediction ref. JGI gene:   122146
Protein sequence: AbPrxII_bisporus
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   180
PWM (Da):   %s   19348.89  
PI (pH):   %s   5.66
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSAVINKDVTLKVGDTIPEGTFKYVPYSPELADNSATGTPQDYNITAEWKGKKVVVVSVPGAFPTCHQQHLPPFIQNYPQFVQKGVDILVVISANDPFVTSAWGRISGSPDKIIYASDMDASWSNKLGLATDQLSKVGFGVRTQRYALVVDDLKVTFIASEGGLGLEHSSAEKIFAHL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 12, 5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTCTGCCGTTATCAACAAAGATGTCACTCTCAAAGTTGGTGATACAATTCCGGAAGGAACTTTTAAATATGTTCCTTATTCGCCCGAACTTGCAGACAACGTAAGCACCCCACCA
CTGTACCACATAACATATCCCTACCGTAAACATTCATATAACATCTACAGTCAGCTACCGGTACCCGTATGTCCCCGTGACTTTCCATTTATCAACTCTGAAGTAAACTTACAAACTCCA
ACTTCCACAGCTCAAGATTACAATATCACTGCAGAATGGAAAGGCAAAAAAGTCGTAGTCGTATCAGTTCCCGGAGCATTTACTGTCAGTGACATTCAGTAAACTATATAAACCAAACAT
ACTCCGAGAGACCTGCAACTGATCGACTTCTTTCTCTTTCTCTCTTTTATAAAGCCGACATGCCACCAACAACATCTCCCACCCTTCATCCAAAACTACCCTCAATTCGTCCAAAAAGGT
GTCGATATCCTAGTCGTCATCAGCGCCAACGACCCATTCGTTACTAGCGCTTGGGGTCGTATCTCCGGTTCCCCAGACAAG
GTTTGTCTCTTTTCCCAAATTGAACCAATTATGCTATAT
ATTTCTGATACAATACTCTACCTGTTACTTCTTAGATCATCTACGCCTCCGATATGGACGCTTCCTGGTCCAACAAACTCGGTCTCGCCACAGACCAATTATCCAAAGTCGGTTTCGGAG
TTCGTACTCAGCGATACGCTTTAGTTGTCGACGATCTTAAGGTCACATTCATCGCC
GTACGTGTCTCGTCCCCTTGGTCTTTAACCACCCTGTACCTCCATGGGTTTAAAATAATTTCTT
CTGACTATTTTATTTTTCAAATTAGAGTGAAGGTGGTCTTGGACTTGAACATTCTTCTGCTGAAAAGATCTTTGCCCATCTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGTCTGCCGTTATCAACAAAGATGTCACTCTCAAAGTTGGTGATACAATTCCGGAAGGAACTTTTAAATATGTTCCTTATTCGCCCGAACTTGCAGACAACTCAGCTACCGGTACC
C
CTCAAGATTACAATATCACTGCAGAATGGAAAGGCAAAAAAGTCGTAGTCGTATCAGTTCCCGGAGCATTTACTCCGACATGCCACCAACAACATCTCCCACCCTTCATCCAAAACTAC
CCTCAATTCGTCCAAAAAGGTGTCGATATCCTAGTCGTCATCAGCGCCAACGACCCATTCGTTACTAGCGCTTGGGGTCGTATCTCCGGTTCCCCAGACAAG
ATCATCTACGCCTCCGAT
ATGGACGCTTCCTGGTCCAACAAACTCGGTCTCGCCACAGACCAATTATCCAAAGTCGGTTTCGGAGTTCGTACTCAGCGATACGCTTTAGTTGTCGACGATCTTAAGGTCACATTCATC
GCC
AGTGAAGGTGGTCTTGGACTTGAACATTCTTCTGCTGAAAAGATCTTTGCCCATCTTTAA

Retrieve as FASTA