Entry information : HcyPrxQ
Entry ID 7611
Creation 2010-09-21 (Christophe Dunand)
Last sequence changes 2012-04-03 (Catherine Mathe (Scipio))
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-12-22 (Achraf Jemmat)
Peroxidase information: HcyPrxQ
Name HcyPrxQ
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Hebeloma
Organism Hebeloma cylindrosporum    [TaxId: 76867 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HcyPrxQ
start..stop
S start..stop
LbiPrxQ01 266 2e-92 1..158 1..158
PplPrxQ01 223 5e-75 1..177 1..172
CcinPrxQ01 214 1e-71 3..172 4..173
PcPrxQ 204 7e-67 6..167 7..170
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 496720..496849 130 N° 2 496609..496659 51 N° 3 496456..496553 98 N° 4 496272..496393 122
N° 5 495972..496206 235  
complement(join(495972..496206,496272..496393,496456..496553,496609..496659,4967 20..496849))


exon

Literature and cross-references HcyPrxQ
Literature Lambilliotte,R., Cooke,R., Samson,D., Fizames,C., Gaymard,F., Plassard,C., Tatry,M.V., Berger,C., Laudie,M., Legeai,F., Karsenty ,E., Delseny,M., Zimmermann,S. and Sentenac,H. Large scale identification of genes in the fungus Hebeloma cylindrosporum paves the way to molecular analyses of ectomycorrhizal symbiosis. New Phytol 164 (3), 505-513 (2004).
DNA ref. JGI genome:   scaffold_9 (496849..495972)
EST ref. GenBank:   CK993011.1 [5' end]   CK995357.1 [5' end]
Protein sequence: HcyPrxQ
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   211
PWM (Da):   %s   22395.53  
PI (pH):   %s   5.09
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPYRSLIGKTAPTITLPNYDGESYTFTPGAKGIPAALFFYPESGSYGCTKEACQFRDAIAEKDNFQPGKVQVIGISPDPVEKQKLFVEKEKLYPVLSDANKEAIKAYGIGKGMLGFVSVARVTFIVDKHGIIRDALETTINAGAHSKFVEKWLHRLEEEGSAPTVTTTAETDLPAPVATATSVSTAAAATTTAAEVPIESQLPVETPGLA

Retrieve as FASTA  
Remarks Complete sequence from 2 ESTs. 3'end is largely divergente from other orthologs(!!!)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCTACCGATCGCTTATTGGCAAGACCGCACCTACGATCACTCTCCCTAATTACGATGGAGAGTCGTACACATTTACACCTGGCGCGAAAGGGATCCCAGCTGCTCTGTTTTTCTAT
CCAGAATCAG
GTACAATGGAACTTATGAAATAACAAGCTCTCATTTAATTGATTTGCTTCTTCCTTAAAGGCTCTTATGGATGTACGAAGGAGGCGTGCCAATTTCGTGATGCCATTGCA
G
GTGAGCTGCAAGATCGAAATAGCAATACATCGTTCGATGCTCATCACTTCGACAGAAAAGGACAACTTCCAGCCTGGTAAGGTCCAAGTCATTGGCATTAGCCCCGATCCTGTGGAGAA
ACAGAAATTGTTCGTCGAGAAAGAGAAATTAACG
GTATGCACTAGTGAATCATGGTATAGACATGTCTCTGTGAAACTGAATGTTATCACACATAGTACCCTGTCCTCAGCGATGCGAAC
AAGGAGGCCATAAAAGCTTATGGTATTGGAAAAGGGATGCTGGGTTTTGTCTCGGTTGCTCGCGTTACCTTCATCGTTGACAAGCATGGAATCATCAG
GTGAGTTACTGCTTACATTCGA
CTATGAATGGAGATTCTCATGCAGATGGTTTTTTGTCCTCTAGGGATGCTTTGGAGACTACCATAAATGCTGGCGCGCATTCTAAGTTCGTGGAGAAGTGGTTGCATAGGCTTGAGGAAG
AAGGTTCCGCCCCTACTGTAACAACGACGGCTGAAACCGATCTCCCAGCCCCTGTCGCCACTGCCACCTCTGTCTCCACTGCCGCCGCTGCCACAACAACTGCGGCTGAGGTTCCCATCG
AGTCTCAACTTCCGGTCGAAACTCCAGGGCTAGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCTACCGATCGCTTATTGGCAAGACCGCACCTACGATCACTCTCCCTAATTACGATGGAGAGTCGTACACATTTACACCTGGCGCGAAAGGGATCCCAGCTGCTCTGTTTTTCTAT
CCAGAATCAG
GCTCTTATGGATGTACGAAGGAGGCGTGCCAATTTCGTGATGCCATTGCAGAAAAGGACAACTTCCAGCCTGGTAAGGTCCAAGTCATTGGCATTAGCCCCGATCCTGTG
GAGAAACAGAAATTGTTCGTCGAGAAAGAGAAATTAACG
TACCCTGTCCTCAGCGATGCGAACAAGGAGGCCATAAAAGCTTATGGTATTGGAAAAGGGATGCTGGGTTTTGTCTCGGTT
GCTCGCGTTACCTTCATCGTTGACAAGCATGGAATCATCAG
GGATGCTTTGGAGACTACCATAAATGCTGGCGCGCATTCTAAGTTCGTGGAGAAGTGGTTGCATAGGCTTGAGGAAGAA
GGTTCCGCCCCTACTGTAACAACGACGGCTGAAACCGATCTCCCAGCCCCTGTCGCCACTGCCACCTCTGTCTCCACTGCCGCCGCTGCCACAACAACTGCGGCTGAGGTTCCCATCGAG
TCTCAACTTCCGGTCGAAACTCCAGGGCTAGCTTGA

Retrieve as FASTA