Entry information : HcyPrxII
Entry ID 7612
Creation 2010-09-21 (Christophe Dunand)
Last sequence changes 2010-09-21 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: HcyPrxII
Name HcyPrxII
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Hebeloma
Organism Hebeloma cylindrosporum    [TaxId: 76867 ]
Cellular localisation N/D
Tissue type Mycelium
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HcyPrxII
start..stop
S start..stop
CcinPrxII 261 4e-91 2..171 4..171
AthiPrxII 256 3e-89 3..171 6..172
LbiPrxII 255 1e-88 1..171 1..169
SlutPrxII01 254 4e-88 1..171 4..172
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1033488..1033565 78 N° 2 1033416..1033431 16 N° 3 1033287..1033357 71 N° 4 1033083..1033229 147
N° 5 1032888..1033031 144 N° 6 1032768..1032827 60  
complement(join(1032768..1032827,1032888..1033031,1033083..1033229,1033287..1033 357,1033416..1033431,1033488..1033565))


exon

Literature and cross-references HcyPrxII
Literature Muller,T. and Wipf,D. EST analysis of a Hebeloma cylindrosporum expression cDNA library.
DNA ref. JGI genome:   scaffold_7 (1033565..1032768)
EST ref. GenBank:   EG950094.1
Protein sequence: HcyPrxII
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   171
PWM (Da):   %s   18036.52  
PI (pH):   %s   5.78
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSIKVGDKIPEATFKYVPYTPELENGLACGVPTSLSTNEWKGKKVVIVSVPGAFPTCHVNHLPPFVQKYDEFKAKGVDVVAVVAANDPFVMSGWGRVEGLKDKILSLSDPDAEWSKKLGLSLDLTGAGLGLGVRTGRYALIIDDLVVKYVGAETGKDVSVSGVDAVLAKL*

Retrieve as FASTA  
Remarks Complete sequence from 4 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTATCAAAGTCGGCGATAAAATCCCAGAAGCCACCTTCAAATATGTGCCATATACTCCCGAGCTCGAGAACGGCGTAAGTCGCATCATTTCAAACTCTCGAAATCTCCACCTCATC
TCCTGAATCTCCAGCTCGCTTGTGGTGTCCGTAAGTGATCTAGGAATAAAATATCATGAAACTGCACCCACCTAATTCCATTTCTCAGCCACCTCGTTATCGACGAATGAATGGAAGGGG
AAGAAAGTTGTCATCGTCTCCGTCCCCGGAGCTTTCACA
GTATCTTATTTCCGGTTGGCCCGAAAGGATGTCATCACTAATGAGAACAATTTCTAGCCAACCTGCCATGTGAACCATCTT
CCCCCTTTCGTCCAGAAATACGACGAATTCAAGGCGAAGGGCGTTGATGTCGTCGCCGTTGTCGCCGCCAACGACCCATTCGTAATGAGTGGTTGGGGTCGCGTTGAAGGTCTCAAGGAT
AAG
GTGTGTACGAGCATCGCAGACAGGAGAGAATTCTGATTAAGCGTTTCCCAGATCCTCTCCCTGTCTGATCCTGATGCAGAATGGTCCAAGAAGCTCGGTCTTTCTTTGGACCTCACT
GGCGCGGGGTTGGGTTTGGGTGTCCGAACTGGTCGTTACGCCTTGATCATCGATGACCTTGTGGTCAAATACGTTGGT
GTAAGTGTTTATCATTTCCATTTTCACATTTTTATCTGGTTT
ACATATGTTCATTCCTAGGCCGAGACTGGTAAGGACGTCAGCGTTTCAGGAGTAGACGCCGTTCTCGCTAAGTTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTATCAAAGTCGGCGATAAAATCCCAGAAGCCACCTTCAAATATGTGCCATATACTCCCGAGCTCGAGAACGGCCTCGCTTGTGGTGTCCCCACCTCGTTATCGACGAATGAATGG
AAGGGGAAGAAAGTTGTCATCGTCTCCGTCCCCGGAGCTTTCACA
CCAACCTGCCATGTGAACCATCTTCCCCCTTTCGTCCAGAAATACGACGAATTCAAGGCGAAGGGCGTTGATGTC
GTCGCCGTTGTCGCCGCCAACGACCCATTCGTAATGAGTGGTTGGGGTCGCGTTGAAGGTCTCAAGGATAAG
ATCCTCTCCCTGTCTGATCCTGATGCAGAATGGTCCAAGAAGCTCGGT
CTTTCTTTGGACCTCACTGGCGCGGGGTTGGGTTTGGGTGTCCGAACTGGTCGTTACGCCTTGATCATCGATGACCTTGTGGTCAAATACGTTGGT
GCCGAGACTGGTAAGGACGTCAGC
GTTTCAGGAGTAGACGCCGTTCTCGCTAAGTTGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCACGAGCTA CAATGTCTAT CAAAGTCGGT GATAAAATCC CAGAAGCCAC CTTCAAATAT GTGCCATATA CCCCCGAGCT CGAGAACGGC CTCGCTTGTG GTGTCCCCAC CTCGTTATCG  ACGAATGAAT GGAAGGGGAA GAAAGTTGTC ATCGTCTCCG TCCCCGGAGC TTTCACACCA ACCTGCCATG TGAACCACCT TCCCCCTTTC GTCCAGAAAT ACGACGAATT CAAGGCGAAG  GGCGTTGATG TCGTCGCCGT TGTAGCCGCC AACGACCCAT TCGTAATGAG TGGTTGGGGT CGCGTTGAAG GTCTCAAGGA TAAGATCCTC TCCCTCTCCG ATCCTGATGC AGAATGGTCC  AAGAAGCTCG GCCTTTCTTT GGACCTCACC GGCGCGGGGT TGGGTTTGGG TGTCCGAACT GGTCGTTACG CCTTGATCAT CGATGACCTT GTGGTCAAAT ACGTCGGCGC CGAGACTGGT  AAGGACGTCA GCGTTTCAGG AGTAGACGCC GTTCTCGCTA AGTTGTAATC CAACATTATG AATCTCGGAC CGAAGTCGCA GAATAAGCAG GAAAAATTGT ATTGTTACAT AGCATACCTA 
TTAGAATGAA CCTTGCAAGT TGTCGTATCA GTCGTACGCT CGAAATCAAG GTCGTGATTA TGAAAAAAAA AA 

Retrieve as FASTA