Entry information : Hcy1CysPrx
Entry ID 7613
Creation 2010-09-21 (Christophe Dunand)
Last sequence changes 2010-09-21 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: Hcy1CysPrx
Name Hcy1CysPrx
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Cortinariaceae Hebeloma
Organism Hebeloma cylindrosporum    [TaxId: 76867 ]
Cellular localisation N/D
Tissue types Hyphae
Mycelium
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Hcy1CysPrx
start..stop
S start..stop
Lbi1CysPrx 423 2e-153 1..222 1..222
Amus1CysPrx 409 1e-147 1..222 1..222
Athi1CysPrx01 407 3e-147 1..222 1..222
Pc1CysPrx01 400 3e-144 1..222 1..222
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 659790..659885 96 N° 2 659941..660147 207 N° 3 660202..660294 93 N° 4 660348..660442 95
N° 5 660500..660510 11 N° 6 660566..660696 131 N° 7 660749..660781 33  
join(659790..659885,659941..660147,660202..660294,660348..660442,660500..660510, 660566..660696,660749..660781)


exon

Literature and cross-references Hcy1CysPrx
DNA ref. JGI genome:   scaffold_3 (659790..660781)
EST ref. GenBank:   CK994821.1 [5' end]   CK993882.1 [3' end]
Protein sequence: Hcy1CysPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   222
PWM (Da):   %s   24896.93  
PI (pH):   %s   6.25
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSLRLGNIAPDFEAQTTAGPIKFHDWIGDSWAILFSHPGDFTPVCTTELGEVARRSKDFEKRNVKVIGISANGLDEHEKWVKDINEYGSKVAPTEVEFPIIADPDRKISTLYDMLDEQDATNRDAKGLPFTIRTVFVIDPKKTIRLTLAYPASTGRNFDEIIRVISLQIGDKHRVTTPVNWKKGEDVIVHPGVTNEEAKTLFPQFSQHLPYLRTTPLKV

Retrieve as FASTA  
Remarks Complete sequence from 9 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCTCTCAGACTTGGAAATATTGCCCCCGACTTTGAGGCTCAGACCACCGCTGGCCCCATCAAGTTCCATGACTGGATCGGTGACTCTTGGGTAAGGCTTTTCTTTCTTTTCCTT
GGTAATTCAGCATGTCATGCGCCCCCCGCAGGCCATTCTCTTCTCCCACCCCGGAGATTTCACCCCCGTTTGCACCACCGAGCTCGGTGAGGTCGCTCGTCGCTCCAAAGACTTCGAAAA
ACGCAACGTCAAAGTCATCGGAATCTCTGCCAATGGCCTGGACGAGCATGAGAAATGGGTAAAGGACATCAATGAGTATGGATCCAAAGTCGCGCCCACAGAGGTCGAATTTCCAATC
GT
ATGTCCTTCATGTACCCTGTCATGCTTGCTGAACCTGAGGCACCCTCCTTAGATCGCCGATCCCGACAGGAAGATCTCTACCTTGTACGATATGTTGGACGAACAGGACGCGACTAACCG
TGATGCCAAAGGCCTCCCCTTCACC
GTAAGAGTCTTTGAAACATGTTTCGCGATGCATCCTCAGAGCTCGGCTTATAGATCCGGACAGTCTTCGTGATTGATCCCAAAAAGACCATCCGT
CTCACTCTTGCCTACCCCGCCTCTACTGGCCGCAACTTTGACGAGATCATTCG
GTGAGCTTGCCATCAGCGGAGATAGCATGCATATGTATTGATTTCCGTTATATCTAGCGTTATCGAC
T
GTAATTATCTGTCTGATTGGCCTTCTTTCGATTTGATGATTGACCGCTCCCACAGCCCTTCAAATCGGCGATAAACACCGCGTTACCACCCCCGTCAACTGGAAGAAAGGCGAGGATGT
CATTGTCCACCCTGGGGTTACCAACGAAGAGGCCAAGACACTGTTCCCTCAATTTAGCCAGCACCTG
GTAGGCATCATTTAACGAATGATTGTGGAAGATATTGCTGACTTGATGACAGC
CTTACCTGAGAACCACACCTCTCAAAGTTGAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCTCTCAGACTTGGAAATATTGCCCCCGACTTTGAGGCTCAGACCACCGCTGGCCCCATCAAGTTCCATGACTGGATCGGTGACTCTTGGGCCATTCTCTTCTCCCACCCCGGA
GATTTCACCCCCGTTTGCACCACCGAGCTCGGTGAGGTCGCTCGTCGCTCCAAAGACTTCGAAAAACGCAACGTCAAAGTCATCGGAATCTCTGCCAATGGCCTGGACGAGCATGAGAAA
TGGGTAAAGGACATCAATGAGTATGGATCCAAAGTCGCGCCCACAGAGGTCGAATTTCCAATC
ATCGCCGATCCCGACAGGAAGATCTCTACCTTGTACGATATGTTGGACGAACAGGAC
GCGACTAACCGTGATGCCAAAGGCCTCCCCTTCACC
ATCCGGACAGTCTTCGTGATTGATCCCAAAAAGACCATCCGTCTCACTCTTGCCTACCCCGCCTCTACTGGCCGCAACTTTGAC
GAGATCATTCG
CGTTATCGACTCCCTTCAAATCGGCGATAAACACCGCGTTACCACCCCCGTCAACTGGAAGAAAGGCGAGGATGTCATTGTCCACCCTGGGGTTACCAACGAAGAGGCC
AAGACACTGTTCCCTCAATTTAGCCAGCACCTG
CCTTACCTGAGAACCACACCTCTCAAAGTTGAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTTCTC TCAGACTTGG AAATATTGCC CCCGACTTTG AGGCTCAGAC CACCGCTGGC CCCATCAAGT TCCATGACTG GATCGGTGAC TCTTGGGCCA TTCTCTTCTC CCACCCCGGA  GATTTCACCC CCGTTTGCAC CACCGAGCTC GGTGAGGTCG CTCGTCGCTC CAAAGACTTC GAAAAACGCA ACGTCAAAGT CATCGGAATC TCTGCCAATG GCCTGGACGA GCATGAGAAA  TGGGTAAAGG ACATCAATGA GTATGGATCC AAAGTCGCGC CCACAGAGGT CGAATTTCCA ATCATCGCCG ATCCCGACAG GAAGATCTCT ACCTTGTACG ATATGTTGGA CGAACAGGAC  GCGACTAACC GTGATGCCAA AGGCCTCCCC TTCACCATCC GGACAGTCTT CGTGATTGAT CCCAAAAAGA CCATCCGTCT CACTCTTGCC TACCCCGCCT CTACTGGCCG CAACTTTGAC  GAGATCATTC GCGTTATCGA CTCCCTTCAA ATCGGCGATA AACACCGCGT TACCACCCCC GTCAACTGGA AGAAGGCGAG GATGTCATTG TCCACCCTGG GGTTACCAAC GAAGAGGCCA  AGACACTGTT CCCTCAATTT AGCCAGCACC TGCCTTACCT GAGAACCACA CCTCTCAAAG TTGAGTAAAT GCGAATTTAA ATGTATTCGA AAATTTTGGA GAGGCGGAAT TGAAGAATAC 
ATATGTAATC TGTAACTGCT AAATTCAACT TGTT 

Retrieve as FASTA