Entry information : CpurNOx01 (CpNox1)
Entry ID 7619
Creation 2010-09-29 (Christophe Dunand)
Last sequence changes 2010-09-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-09-30 (Christophe Dunand)
Peroxidase information: CpurNOx01 (CpNox1)
Name (synonym) CpurNOx01 (CpNox1)
Class Ancestral NADPH oxidase    [Orthogroup: NOx002]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Clavicipitaceae Claviceps
Organism Claviceps purpurea (ergot fungus)    [TaxId: 5111 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpurNOx01
start..stop
S start..stop
EfeNOx 1028 0 1..557 1..557
GzNOx01 961 0 1..557 1..557
NcNOx01 956 0 10..557 6..553
MgrNOx01 934 0 9..557 5..553
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 366..478 113 N° 2 587..2070 1484 N° 3 2212..2288 77  
join(366..478,587..2070,2212..2288)


exon

Literature and cross-references CpurNOx01 (CpNox1)
Literature Giesbert,S., Schuerg,T., Scheele,S. and Tudzynski,P. The NADPH oxidase Cpnox1 is required for full pathogenicity of the ergot fungus Claviceps purpurea. MOLECULAR PLANT PATHOLOGY (2008), 9(3), 317–327.
DNA ref. GenBank:   AM899998.1 (366..2288)
Protein sequence: CpurNOx01 (CpNox1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   557
PWM (Da):   %s   63925.79 Transmb domain:   %s   i20-37o57-79i105-127o142-164i177-199o
PI (pH):   %s   9.45
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
SIFFTRAHLHDE*LPLMCMTTIPRPEL*AHRSHMFCRRSRFITCLGTAIRCRHRVGIVHCPRRVASQVDALYESHPAKGNTSSNPSWRENTDIASCFANSSLLRSSSSTFYSGDSMWPSLCTARE*KDILASFSRNFALAIPRLEVQDNSLDFNGNSDTGTNKQRMSGWQDSTPSSTQSGSQEAPVWFLPSMEP*FSCQCAAQRCAGFVPSFASYLWTRTSGFIDNWRTRCSSLW*STWAPTTSTFTALRKRKFGPSVLFKFTTTRPVGLQDM*CFSVCCSCTRRHIRASVSSHLKHSGTHTTSSSHLCWLCTRTRWAASSAILSAPSPPLTERNTGNTA*VI*AGAGSYGPAVCTWSSGCIVRFVPVAKPKSPELSVTRTTSSKSSSVSRPSATKLVSGCFSRCLRFPSTNGTLSPSHPALMTPTYQST*DKSATSPALSATQPVPVPHKRSSTKTSIPMACTK*HSKTASKCPTSASTAPMALPQKMSSKTKSPSSSAPASASPPGLLSSKTSGTCATLPTRPLASAVS*VSTWTRRKTLFSIA*AQTQTPSLN

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCCATCTTCTTCACTCGAGCCCATCTCCATGATGAATAGCTTCCACTTATGTGCATGACGACCATCCCGCGCCCCGAACTCTAAGCGCACCGTTCACACATGTTCTGCCGCCGTCAGCCT
CGTATACTGGCTTGTCACGAGTTGCAAGCTTTGATCACGTCCTTGGATCAACCTGGAATCTGTAACCCGAACAGATCTTGACTCCCTGACTGCCATCTTTTCAGCAGGTTCATCACCTGT
CTCGGCACAGCGATTCGTTGCCGCCACCGGGTTGGGATTGTTCATTGCCCTCGTCGTGTTGCGTCGCAGGTCGACGCTCTCTACGAAAGCCATCCGGCAAAAGGCAATACATCTAGCAAC
CCGTCATGGCGGGAAAATACGGATATCGCGAGTTGTTTCGCAAACAGTTCACTCCTCAGAAGCTCATCTTCCACATTCTATTCTGGGGACTCCATGTGGCCATCTTTGTGTACGGCTCGT
GAGTAGAAAGATATTCTTGCTTCTTTTTCTCGCAATTTTGCTCTGGCAATTCCTCGCCTGGAGGTGCAAGACAATTCGCTCGATTTTAACGGCAATTCTGATACAGGTACAAACAAGCAA
CGAATGAGCGGCTGGCAGGACTCAACGCCCTCAAGTACTCAGTCTGGATCTCAAGAGGCGCCGGTATGGTTCTTACCGTCGATGGAACCTTGATTCTCCTGCCAGTGTGCCGCACAACGA
TGCGCTGGATTCGTCCCAAGCTTCGCTTCCTACCTCTGGACGAGAACCTCTGGTTTCATCGACAATTGGCGTACGCGCTGCTCATCTTTGTGGTAATCCACGTGGGCGCCCACTACATCA
ACTTTTACAGCATTGAGAAAACGCAAGTTCGGCCCGTCAGTGCTGTTCAAATTCACTACAACCAGGCCGGTGGGATTACAGGACATGTGATGCTTCTCTGTATGCTGCTCATGTACACGA
CGGCACATTCGCGCATCCGTCAGCAGTCATTTGAAACATTCTGGTACACACACCACCTCTTCGTCCCATTTATGCTGGCTCTGTACACGCACACGGTGGGCTGCTTCGTCCGCGATTCTG
TCCGCGCCTTCTCCCCCTTTGACGGAGAGAAATACTGGAAACACTGCATAGGTTATCTAGGCTGGCGCTGGGAGCTATGGGCCGGCGGTCTGTACTTGGTCGAGCGGCTGTATCGTGAGA
TTCGTGCCCGTCGCAAAACCCAAATCACCCGAGTTGTCCGTCACCCGTACGACGTCGTCGAAATCCAGTTCAGTAAGCCGTCCTTCCGCTACAAAGCTGGTCAGTGGCTGTTTCTCCAGA
TGCCTTCGATTTCCAAGTACCAATGGCACCCTTTCACCATCACATCCTGCCCTTATGACCCCTACATATCAATCCACGTGAGACAAGTCGGCGACTTCACCTGCGCTCTCGGCGACGCAA
CCGGTGCCGGTGCCGCACAAGCGAAGCTCTACGAAGACGTCGATCCCTATGGCATGTACGAAGTAGCACTCCAAAACGGCCAGCAAATGCCCGACCTCCGCATCGACGGCCCCTATGGCG
CTCCCGCAGAAGATGTCTTCGAAAACGAAATCGCCGTCCTCATCGGCACCGGCATCGGCGTCACCCCCTGGGCTTCTATCCTCAAAAACATCTGGCACCTGCGCAACTCTCCCAACCCGC
CCTCTCGCCTCCGCCGTGTCGAATT
CATCTGGGTCTGCAAGGACACGGGCTCTTTCGAGTGGTTCCAGACCCTCCTGTCCTCGCTGGAAGACCAGTCCAACGAAGCGGCTCACCTCCCGG
GCGGTTCTGGCGTCGAGTTCCTCAAGATTCATACCTATCTCACCCAGAGTCTCGACATGGACACGACGCAAAACATTGTTCTCAATAGCGTAGGCGCAGACACAGACCCCCTCACTGAAC
TAA

Retrieve as FASTA