Entry information : CpurNOx02 (CpNox2)
Entry ID 7620
Creation 2010-09-29 (Christophe Dunand)
Last sequence changes 2010-09-29 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-09-30 (Christophe Dunand)
Peroxidase information: CpurNOx02 (CpNox2)
Name (synonym) CpurNOx02 (CpNox2)
Class Ancestral NADPH oxidase    [Orthogroup: NOx001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Clavicipitaceae Claviceps
Organism Claviceps purpurea (ergot fungus)    [TaxId: 5111 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CpurNOx02
start..stop
S start..stop
CgNOx02 946 0 19..574 22..573
GmoNOx02 943 0 14..574 2..562
GzNOx02 939 0 14..574 2..560
NcNOx02 925 0 18..574 18..571
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 601..791 191 N° 2 954..2487 1534  
join(601..791,954..2487)


exon

Literature and cross-references CpurNOx02 (CpNox2)
Literature Giesbert,S., Schuerg,T., Scheele,S. and Tudzynski,P. The NADPH oxidase Cpnox1 is required for full pathogenicity of the ergot fungus Claviceps purpurea. MOLECULAR PLANT PATHOLOGY (2008), 9(3), 317–327.
DNA ref. GenBank:   AM899999.1 (601..2487)
Protein sequence: CpurNOx02 (CpNox2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   574
PWM (Da):   %s   65392.53 Transmb domain:   %s   i64-86o101-123i144-166o181-203i224-246o256-278i317-334o422-444i
PI (pH):   %s   9.17
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GHW*RILALEQAIYAGRRMIRK*GIMEKLNNLGISL*VDT*LLRGDFSSSGRCTRCGRRELLAGGSELLLKITTSSLAPYCISSRPVDPFWDRASQRLASRSPPPGLLPVSVFRSATLA*TGRAKKKRENRENWVTLSHWTDTPTVMDSPLELPNAPFQRTWERRSSEQERWTELTRLLLSGKMTQEKQQELSSREKFDRWMINEGQRRV*VCLLSLCED*ESGRRRENWELARKRKLRNKRNHKGQRKKRTHKKKGCQANALRFVFVFALLHALIFVFASIHYSLKDSLQGARDVFGFSFTVSRAAALVLHVDVALILFPVCRTLVSLARQTPLNGIIQFDKHITFHITTAWSMVFFSWVHVIAHWTNFARLAAKNNLGFYGWLLANFASGPGWTGYVMLIALMGIVVTSIEKPRRANYERFWYTHHLFVVFFLFWSLHGAFCMIQPDVAPFCSGVGTAAVGVFWKYWMYGGFVYLAERVAREIRGRHKTSILKVIQHPSRVCEIQIRKEKTKVRAAGQYILFCCPAVSLWQYHPFTLTSAPEEDYI*FIFAARATSPWLWPAHSDATGTARA

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGTCACTGGTGACGAATTTTAGCTTTGGAGCAGGCCATCTACGCGGGGAGAAGAATGATAAGAAAATGAGGAATCATGGAGAAGCTTAACAACCTAGGTATATCTTTGTAGGTAGATACC
TAGCTTCTTCGTGGCGATTTTTCCTCTTCTGGCAGATGCACTCGTTGTGGGCGCAGGGAGTTGCTTGCTGG
CTTAGACGAGGACCTAGTTGAAGCTTGCGAAGTCAATGCGCTGGCTGTC
ATTGCCCGTGCATTTTCCTTCCTACCTACTCTTCGTTTCTTCGACGGATTTCTATGTGTTGTATTCTCCAATTTTTTTAAAAAAATCTATTCTTCATGTTTTGAAAATTCAGCAGGATCT
GAACTTCTGTTGAAGATAACAACGTCGTCGCTCGCTCCCTACTGCATCTCCTCGAGGCCCGTGGATCCGTTCTGGGATAGAGCATCGCAGCGCCTTGCCTCACGTTCGCCGCCCCCTGGC
CTCCTCCCCGTCTCCGTCTTCCGAAGCGCAACGCTCGCTTGAACTGGGAGGGCAAAAAAAAAGAGGGAAAACAGGGAAAATTGGGTGACCCTTTCGCATTGGACGGACACGCCGACCGTC
ATGGATAGTCCCTTGGAACTACCGAATGCGCCCTTTCAGCGAACGTGGGAACGGCGGTCGTCCGAGCAGGAAAGATGGACGGAACTCACGAGATTGCTCCTCTCGGGCAAGATGACACAG
GAAAAGCAGCAGGAACTTTCGTCGAGGGAAAAATTTGATCGGTGGATGATTAATGAGGGGCAACGACGGGTGTAAGTCTGTTTGCTGTCGTTATGTGAAGATTGAGAATCAGGGCGGCGG
CGGGAAAATTGGGAATTGGCGAGGAAGAGAAAATTGAGGAATAAGAGGAACCACAAGGGCCAGAGGAAGAAGAGGACTCATAAGAAGAAAGGATGCCAAGCTAACGCGCTCAGATTTGTC
TTCGTCTTCGCGCTCTTACATGCGCTCATCTTCGTCTTTGCCTCGATCCACTACTCCCTCAAAGACAGTCTACAAGGCGCCAGGGACGTCTTCGGCTTCAGTTTCACGGTATCTCGCGCA
GCCGCCCTCGTCCTGCACGTCGATGTGGCCCTCATTCTATTCCCCGTGTGCCGCACGCTGGTGTCGCTCGCGCGCCAGACGCCTCTCAACGGCATTATCCAGTTCGACAAGCACATCACG
TTCCACATCACGACGGCGTGGTCAATGGTCTTTTTCTCGTGGGTGCACGTCATTGCTCACTGGACCAATTTTGCCCGCCTCGCGGCGAAAAACAACCTGGGCTTCTACGGATGGCTTCTG
GCCAACTTTGCCTCCGGGCCTGGCTGGACGGGGTATGTGATGCTCATCGCGCTCATGGGCATCGTGGTAACGTCCATTGAGAAGCCTCGACGAGCCAATTACGAGCGGTTCTGGTACACG
CACCACCTATTCGTCGTCTTCTTCTTGTTCTGGTCTTTGCATGGCGCGTTCTGCATGATCCAGCCCGATGTGGCGCCCTTTTGCTCCGGTGTCGGGACCGCCGCCGTGGGCGTCTTCTGG
AAGTATTGGATGTACGGCGGCTTCGTGTACCTGGCGGAGCGGGTGGCGCGAGAGATTCGCGGCCGGCACAAGACGTCCATTCTCAAAGTCATACAGCACCCCAGCCGGGTATGCGAGATC
CAGATTCGGAAGGAAAAGACCAAGGTGCGTGCCGCCGGACAGTATATCCTGTTTTGCTGTCCGGCTGTGTCGCTGTGGCAGTATCATCCCTTTACCCTGACGAGCGCACCCGAGGAGGAC
TACATCTGATTCATATTCGCTGCCAGGGCGACTTCACCATGGCTGTGGCCCGCGCACTCGGATGCGACTGGGACCGCAAGGGCGACA

Retrieve as FASTA