Entry information : Cja1CysPrx01
Entry ID 7628
Creation 2010-10-15 (Myriam Duval)
Last sequence changes 2016-06-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-06-28 (Christophe Dunand)
Peroxidase information: Cja1CysPrx01
Name Cja1CysPrx01
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Metazoa Chordata Mammalia Cebidae Callithrix
Organism Callithrix jacchus (Common marmoset)    [TaxId: 9483 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Cja1CysPrx01
start..stop
S start..stop
Cja1CysPrx01-1 451 2e-164 1..224 1..224
Ptro1CysPrx01-2 446 2e-162 1..224 1..224
Ptro1CysPrx01 446 2e-162 1..224 1..224
Pabe1CysPrx01 446 2e-162 1..224 1..224
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8503..8597 95 N° 2 3921..4077 157 N° 3 2338..2484 147 N° 4 1451..1597 147
N° 5 1..129 129  
complement(join(1..129,1451..1597,2338..2484,3921..4077,8503..8597))


exon

Literature and cross-references Cja1CysPrx01
DNA ref. GenBank:   NC_013913.1 (33360148..33368971)
Protein sequence: Cja1CysPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   224
PWM (Da):   %s   24775.09  
PI (pH):   %s   5.8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGGLLLGDVAPNFEANTTVGPIRFHDFLGDSWGILFSHPRDFTPVCTTELGRAAKLAPEFAKRNVKLIALSIDSVEDHLAWSDINAYNGEEPTEKLPFPIIDDKNRDLAILLGMLDPAEKDEKGMPVTARVVFVFGPDKKLKLSILYPATTGRNFDEILRVVISLQLTAEKRVATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 18, 4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGGAGGTCTGCTTCTCGGGGACGTGGCTCCCAACTTTGAGGCCAATACCACCGTCGGCCCCATCCGTTTCCACGACTTTCTGGGAGACTCGTAAGTGGCCACCGCATAGCCCTGC
TCTGGCCTCGATTGCGCCCGCACTGGGAGATGCCTTCCCTATTTCTTCTCCCTTCCGTCCTTCCCGCTGCTCAGCCCCCTGCGCCGCTCGCCCCCTCCTCCGCACCGGTTCTGGCGCGCG
CCAGGCCATGTGGCCCTTGCTCAGCGTCGGCCGCGCTGCTAGGGGCTGGCATCCACCACTTCGGCCTGCCCTGCGCGGGCTACTAGATCCCTCCTGGTCTCCCTGTCTCTGGCGTGGCTG
GGCGAGGCCACGCCAAGGTGGGGGGTGGGGAGGACAAAATTGGGTTCTGCAGGTCTTAGAAACTCACTGCTCAGGGGAAGGTTTGTTGTCCGTTTAACTCGGATTAGTAAACTGTGCAAG
TAGTCTGGCGGAGGGCGAAGGGGCGGGGCGGCATTGGGAGTATTCCCGGGAATACTGCCCAGGGTCACACCACCTTCCCTCCCACCCTCCGTTCTGGAATTTGCTCCCTAGGGAGGATGG
GTGTCTAAAGCCAAAGGTGGAGGACACAGCTGCTGGCTCTAGTTGGCAGTAGTATTTGCAGGCTTCTGGGCACAAAATGTAAAATTTAAAACTACTAACTGCCAAGTAAGTGGCCGAAAG
ACTTTTTGTCCATAGCCTTCTCCAGTGGCCAAGATATGATCCGATAACAGCTTTGGGAAGAGCCAAGAACACTCTGTGTGTAGGTATGCCTTCAGAGGTTCCAGAACTTGCAACACTTGG
AGGGAAGGACTTTCTGAAGCTGATCAGCTGCAGTGAGCCATTCTCGCCAGTGATGGCTGTTCCAGGTTCCAGGACACGTGTACTCCCCCAGTTTGAGACTCTTTTGTTTCCCAGTGGTGT
GCCCCTCACTGTCCCCTCTACTTGCTGCCTTGCTTCTAGCACATGATAGCCAAATTGATGACCTGTGATCTGACTTGGCTGTTTTACCACTTTGAATAGGAGTAGTTAATCGGTGTTGCC
CTTTTTTTCTTTCTTTTTTTAAACAGTTCCTGAATCAGCAAACTGGAAATTGCTTAGTTTTCATCAGAAGCACTCCAGGCATGTCTAGTTATATTATGGTTCTGGGGTTACAGTGGTCCC
ACTACACTGTGGGGCTCCGAGGCTTGACAATGACAATTCTTCCCCAGTTTATGTCCTTGTTATATACAGTATCCAGGGAGATAAAGAGAGAGGCTTATGAAATTAATCAATGATTGGACA
GGGCTGTGCAGAGAACCAGGGAGAGATTCTTACCCAGCCCCTTACAACCTCTTAAGTCCCTTTTCTAGCCACTGAATAGGGAAAAATTAAGCTTTCTGAAAGATGGGATTAGGCTTAAAA
AACTATTCAAACCTTGAATATGGAAAAATACTTTAGAAATACAGCTTATGGCCAGTCTCATACTAGGTAATATTTCTCCAGCAATCCTTGGGATTTTTAGAGTTGTGTTTCTTCCTGCAG
CCCTCAACGCTATGAAACATAAAATATTTCTAGAACTCTTAGCATGTATAGATTAAATATTAGCATAAAACATTTACTGTGCCAACAGTTATAAATGCTGTCACTTTTTAAACTAACCAT
ACTTTTTTGGGTTTTTGTTAATGTTTATTGGCCTCTAGAGCCATCTAGATTTGATCAAAAGTGGTACCTATCAGGGAGCCATAGTTAGGAACACGACAAAAATATCTGCATTTATTAACT
AATATATACGTCTGCCTAGGATCAGGCACAGTATTCCCGACCTTACCAGGAAAGAAGTTTGTGTTGTTTTGTTTTGTTTTGTTTTTTTGGGACGGAGTTTCACTCTTGTTACCCAGGCTG
GAGTGCAATGGCGCGATCTCAGCTCACCGCAACCTCCGCCTCCTGGGTTCAGGCAATTCTCCTGCCTCAGCCTCCTGAGTAGCTGGGATTACAGGCACGCGCCACCATGCCCAGCTAATT
TTTTGTATCTTTAGTAGAGACGGGGTTTCACCATGTTGACCAGGATGGTCTCGATCTCCTGACCTCGTGATCTACCCGCCTCGGCCTCCGAAAGTGCTGGGATTACAGGCTTGAGCCACC
GCGCCCGGCCAAGTTTGTGTATTTTATATGTTCATGACACATGGATTTTCGCCTGATTTTTCCAAATTCTGTTCTGTATATGATCCCAAGCCAGACTGTCAATTTTTGGTCCAGGTATTT
TTGAGGAGAAAAAATTAAAATGTATTTCTCTACCTTACCTCTGATCATTGTGTTATACCGGACCAAGTATAGAAAGTCAACACGAAGACAAAAGTATGCCAAATTGCAGGGTTTATTGCC
GGCGACCACGGAGGACTCACATCTCTCCAACCTGTGGCTGAGAAAGAAGGGTGACAAGACCTTTTGATACCCATAAAACCACCTTGGGAGTGCGGGTGAGGGGCTTCCGGAATGGACATT
CCGAGGGCCAGGGGACTATTTGACATTCTGATTGTTACTTAAGTGGTTCACAAAAGCCAAGATTAGCATTCATCTACACATTGTCTGGGTAGGGTGGGGATCACAGTCCTTAATTACTTA
TTCACATTTGGGTTATAGACAGCAGTTTCAACAGAAAGCTGAGGTGTGGTTGAGGTATGCAGTTTTATGGGGCTTTTTACCATGTCACAATTGGAAACAACTAGAGGTTGGGTGCTGCAC
TGGGTGAGTTTATTGAGCTTTATCACTGTTTCTGTAGGTGGTAGAAGCAGCTTCTTAGCACTTCTTCACTAAACAAAATATGTGTTTTCCATGGGTATTCTGGGGCTTAGTAAGTGGGGA
CCATTTTCTTGAAGGAGGAAACCTTTTGTCTTGAAAATGAATAAGAAAGGAAATGGGAGAATGTCACTGAATTCCTCCTAAGTGCAGCAGTAGGAAGACTTAGAGGGGAAGGAAGTCCAG
GGTAAGATATTCTTGGAGTTTATCCTATGTAGCCATTCGGAAAAGCTTCTGAGGGAGGGAAGGACAGTAAACTGGCTTAAAACCAGTTCCTTTCTCATGATTCAGCAGAACAGTCTCTAT
TGACTCAATGGAAAAAGAACTCCTAACTTTTCTAATTCATCCTCCCTTTAACAATACAGGAGGAAATGCCCTGTTCCATTTCTTCTCAACTTCTGGAGACCTGTTAAGTCTCATCTAACC
ATTAAATAGATCGTTTTCCATAGAATCTTAAGGCCTGATTTTACTCATAGGGATATTACTTATTTCAAAAGATATACTCTATCTTCTTCTTTTTGAGCTTCATAATAAAATGAACATAGT
GTATACCTCCACAGTCTTAAAAAAAATATATCAACTTTCTTCCCAGTCTTGTCACAGGGCCCTCCATCCTTTTTGTAAGAAGGTCTTTTCCTTCCTGAAACCTTGGGGGGTTGAGTGGCA
GCTGTAGGTGGAAGGAGGTGCCCTTGCCTTTGCTTGTTCTCTGTGTTCAGAGAAACTTTGAAAAGGTCAGCTTGGCATCTAGGCTATTTAGTTATTTACTAGTTTAGGATTCTGCCTAAA
TCATCTGGTTTAGGATGGTTTAAGTTGATGGGGATGCAGATAACTGAGTTAAATTTTCCTTTTCAGTTGAAAACTCCAGCTTTCCTGGTGATATCTTGAAACGTGTTCACAATCTATAAA
ATCTTAGACAATGATGACTTAGATGTTAGTATTTACCTGAGAATTTGCCGCTGTAGAAATCTACATTGTAGGCTATTAGTCTTCTACCTGCTTGGTCCAAAGAGAAGAAAAAGAAACTGC
AAATGAAGAGATACGTAAAACTGTTAAGATTCTATTGTTTTGTCAGGGTGTAAATATTGGGTATCCTGTTTGGCAGGTTAGATTAGTAAAGTGGTTTTACAAAAGACTTTATATCCACTT
GCTTCAAAGAAACCAAATGTCAACGTTTTACAATAAATAGAGGATAGAAACCTATTTATTTCAGATTACATAATCTGTTTATTATTGCAGTCAGGCATTTGTTTGGGTATCCCAGGATGT
TCAGGGCATTTTGGGACATCCATTATTGGAGCTGAATATCAGGGTCTATGCTAGGAAAACAAATATAGAAAAGGATAAGAAATAATTAAGCTTTTTCAGTAAGCTGCTTGGCTTGAATAG
CACAGATTTTATTAGCCAAAAAGGAGTCAGGGTGGCACCACAATTATTAAAGGAGGTAACACCTTAAAAGTAGTCTTTTTAAATATGTGTCATCTTGAATTTTAAATCTTTGATTGAATT
GGGCTATAAGCATAGGCTTCTCTGGAGGTAAGTAGATTGAAAAGCATTACTCAACAGAAAAGTTTAAAAGTAAATGTCGTCATAAGCATTCATTGAAAAAAAGAAAGCCTGTTTTTGATC
CAAAAGTGATGACTTCATTCTATGCGATGTTGGCGATAACACTTCATTCAATTGCGACCTTGTTTTTTTCTTCCTTTCAGATGGGGCATTCTCTTCTCCCACCCTCGGGACTTTACCCCA
GTGTGTACCACAGAGCTTGGCAGAGCTGCAAAGTTGGCACCAGAATTTGCCAAGAGGAATGTTAAATTAATTGCCCTTTCAATAGACAGTGTCGAGGACCATCTTGCCTGGAGCAAG
GTA
TAGTATCAATTGGCGTGTGCTTCAAGCCTGAAACTACAGATCAAGTTATAAATTACAGAGTACTTGGTTTTTGAGGTTAAGATACAAGTAAGTTTCAGGTTCAAAGTTCACTGATTATTT
GAAAATTTCAGTTGAACCGCACAGTGTCACATTGCTAAATCCATTGGTCAGCCAGTTCTCAGCCCTCATCGTGGCCTACCAGCAGCATTCAACCCAGGTGATCATGTGTCCCCTGAAACT
TTTTCCTTTTTTGGCTTCCAGGACACCACATCCTAGCTGTTCCTGTTCACTAATTCTTCATCTCCCAACTCCCAATGTATCCCAATGTATGCTGAAGTTACCATGAACCTTTTTTTAGAC
CTCCTCTCTTTTCTGTCTATACTCTTTCTCTTGGTGAGCTCATCCACTCACATCTTTAAGTACCATCTATATGCTGTGATTCTCAAATTTTCATCTGTAGGCCAGACTTGCAGTATAGCC
ACTGCCTACTCAGCATCTCTCTAGGGATGTCCAGTCATCTCAAACCTAGCATGTCTAACTAGGCCTCATTCTTAAATCCAGAGTTTTACTCATCTCAGCTAATAGCAACTACATTTTTAT
AGTTGTTCACACCCCAAATCCAGGAGCCATTCTTAATTCTTCATGTTTTTTCACATTATACATCTGATTTATCCTCAAACTTGTCAGCTCACTCTTCAAAATGTCCTGTATCATATATGG
AAGACTCCCCAGGGATCTGTGCGACTTCCCTTCACCTCTTTTGGGTCTCAACTCACAGGACATTTCATCAATGCCTTTCCTGTCCTCATTATATAAAATTGTAACTCCTTTTCACATTCA
CTGTCCCCTTCTCCTCAGCACGTGTCACCATCTCAAATACTCTGCATATTATTTAGTGTTTCTCCCCAGTAGAGTGTTGACTCAGCAGGAACAGAGACTTCTATTTTGTGCACTGCTGGA
ACAATGCTCACTACTCAGTACACCTCAGGTGATCGGTCAATATTTGTTGAATGAATTAATTGAAGGAATTATCTGCTTTTAGCAAAAGAATTTACCTAAAATTGGGTGGTCTAATTTTAC
CTTGAAAACATGTTAAGGACTTGCTACAATGTATTCTTAAGTAACAATGATAACTACTTATCGAGGGATGCTTACTGTTTACTAATCACTATGTCAAGCACATGCAATTGAATAAAAGAT
ACATTGAAGTGTAAGTAAGGGAAAATGGCTTTGGTCCATGGTTTCAACCCAAGTACTATACTCTACTGTTAATCCTGGCAATCATTGGGATGAAGAGTGTTCATTTATTCGTCTTTTAAA
ATTAAAATTGCTTAAAGACAATTACTGTGATATGGTCCCCTTTTCTGTTGACTGGATGAAACTCAGGATGTGTTGGGTTTGGATTCCCCTAACCCTTTTACTTATGGTTTCAGGATATCA
ATGCTTACAATGGTGAAGAGCCCACAGAAAAACTACCTTTTCCCATCATTGATGATAAGAATCGGGACCTTGCCATCCTGTTGGGCATGCTGGATCCAGCAGAGAAGGATGAAAAGGGCA
TGCCTGTGACAGCTCGTGTG
GTAGGTCATACAAATTCATTTTGTAGTTAGCATAACTGATCAGACTGTATATTCTATGTACGTGCTTATACCAGCTGGAGGAGATAGGGAAATAGCTACA
ATTATGAAATAACTGTATATTGTTGAAAATGTCACTGATTATCTGTAATGCTGATGCGAAGTGGCTGAAGTTTTCAGCTAAATTTTTCAACTTAATTCATAGCTCATGGAAATCTACAAA
AAAATAAGTTGTTTATACCAAAATGTCCTCCAGAATTGAGAAACCTTTTTATAGTTGTCCTGACCTCCCTGTCTTAAAAGTGATGGGCCACATCCTTCTTCATAAGGCAGCTGTTTTAAA
ATTTTTATTTGTTCTGTCCTCTGCCCACTAGAGAACAAACCCAATCCCTCATCTGAATAAATGTACATATTCAAGGAACAATATCAACTCCCATTAGTATTATTTTTATGATAGTCATCC
CCAACTGACCCAGCCTTTCCTGGATTAAATTTGCATATCAGCTTTCCTTACTGGATAGCCAGAACCAAGTAGAATTCTCTTCTGAATTTAGGAAAATAATAGGGAGAAGAGAATTACCTG
TATTCCAATCATCCACTTTAGCAGATTGGTGTATCCTTCCAGGTTTTTGTCTTGCTTTTATACCCCTGAACAGTATTAATGACTCAGAGCTTTCTAAGTGGCTTTAATATCAAAAACATT
CAAAGAACTCCTCCTATTTATGCCTTTCTGTGCTTTGCAGGTATTTGTTTTTGGTCCTGATAAGAAGCTGAAGCTGTCTATCCTCTACCCAGCTACCACTGGCAGGAACTTTGATGAGAT
TCTCAGAGTAGTCATCTCTCTCCAGCTGACAGCAGAAAAGAGAGTTGCCACCCCAGTTGATTGGAAG
GTAAAGATATTTAAAAAAGCATTTTCTCAATTTGCCTGGAAGGCCTGAAGGGC
CAGTCTCTAAAGGCCAACTACCAGGTCTGTGTTTCCTGGGGCTCTGTTTATGACACGCAGGTACACTGGGAGGATTTTTCCTCATGGCTGAGTTTAAGGTTTGCTGGTAAGCCCTTTTCA
AGGTCTTTGTATCACCTTTTGTATACAACACAAACTTCCTATATATTGCATGCCAACTTTTAGATAATTTGGAAAAATTATTGGTCAGAATGATTGCTTTTCCTAATGGGAGATTTTAAA
AAAAAAAAAAAGAAGCAGCAGCAGCTTTTATCTAACCCTTCCCTGGTGGCAAAATATTTATCACACAATCTTGATCGGCCATTTCTGTTAAGTTATGTATTAATGTCATTAAGTATTTCA
TTTCTTTTAAGCTTCATGCTTTTAAATCTGTGCTAGAATTCTCCAAAATTTGTTCATAAACTTTTTAATCTTTAGGACATGGATAACACCATATCACAAGAGTATCTTAACATTGCTACA
TTTTTTAAATAAGGCTAACCTGAATACCAGGTTTTATTTTGTTATTTTTTGCTAACAAACAAATCACTTAAATTCTGTATCCACTAGTTAATGTATTATTACTTATATACTTACTGAGCC
CAGATAGCAGTGAACAATAGAAAGTCTTTCCCCTCATAGAACTTCCATTCCAGTGAGTGGAGACAAACGGTAAACAAATTTATTAAGTGCTACGGGAGAATCAGACACAGATGGTGAGAA
TAACAGCACAGGATGGGATGGGAGTGTGACTGTTGAGGAATGTCTGTCTGTGAAGGGACCTTGGGGAAGAAAGACATGGCGAAGATGTATATTTGTGAGGGACAAGCCCTGCAGGCAGAA
GGAGTAGTTAGTGCAAGAAGCTGGGCCTGCAAGTGAGCCGGGCATGTTGGAGGAATACAAAGAAAGCAGCATGCCTGGAGAAGAAGCTGCAGAAGGTGGGGTGAGGGACTAGAGACGAGA
GGAGGCAGGATTCTGTCACACAGGGCCTATAATGGGCCATGATACTCCCTTAGAATAAAATTTAAAAGGTGGTGGCTGGCTGATACTGGGTTTAAAACAGTGCTGTTTCTTGTTAAGATA
AGGGAACTACTTTTCCTCCAAAAAAACACCAAAGATCAACTTGGAAAACAAAATCCTCAGAGAGGAGAGAATAAAGAACACTTGATCAGTCTCATTAGTGCCTGTAGCTACTTTTCTGAA
GTTAATTCTTGAAGGTCTTGAAGCTTCACTGAGATTGAATTTCACCATTCTCAAATGTCTTTCAATAGGATGGGGATAGTGTGATGGTCCTTCCAACCATCCCTGAAGAAGAAGCCAAAA
AACTTTTCCCAAAAGGAGTCTTCACCAAAGAGCTCCCATCTGGCAAGAAATACCTCCGCTACACACCCCAGCCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCTGGAGGTCTGCTTCTCGGGGACGTGGCTCCCAACTTTGAGGCCAATACCACCGTCGGCCCCATCCGTTTCCACGACTTTCTGGGAGACTCATGGGGCATTCTCTTCTCCCACCCT
CGGGACTTTACCCCAGTGTGTACCACAGAGCTTGGCAGAGCTGCAAAGTTGGCACCAGAATTTGCCAAGAGGAATGTTAAATTAATTGCCCTTTCAATAGACAGTGTCGAGGACCATCTT
GCCTGGAGCAAG
GATATCAATGCTTACAATGGTGAAGAGCCCACAGAAAAACTACCTTTTCCCATCATTGATGATAAGAATCGGGACCTTGCCATCCTGTTGGGCATGCTGGATCCAGCA
GAGAAGGATGAAAAGGGCATGCCTGTGACAGCTCGTGTG
GTATTTGTTTTTGGTCCTGATAAGAAGCTGAAGCTGTCTATCCTCTACCCAGCTACCACTGGCAGGAACTTTGATGAGATT
CTCAGAGTAGTCATCTCTCTCCAGCTGACAGCAGAAAAGAGAGTTGCCACCCCAGTTGATTGGAAG
GATGGGGATAGTGTGATGGTCCTTCCAACCATCCCTGAAGAAGAAGCCAAAAAA
CTTTTCCCAAAAGGAGTCTTCACCAAAGAGCTCCCATCTGGCAAGAAATACCTCCGCTACACACCCCAGCCTTAA

Retrieve as FASTA