Entry information : CjaGPx02
Entry ID 7629
Creation 2010-10-15 (Myriam Duval)
Last sequence changes 2010-10-15 (Myriam Duval)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-10-19 (Christophe Dunand)
Peroxidase information: CjaGPx02
Name CjaGPx02
Class Animal glutathione peroxidase    [Orthogroup: Gpx1004]
Taxonomy Eukaryota Metazoa Chordata Mammalia Cebidae Callithrix
Organism Callithrix jacchus (Common marmoset)    [TaxId: 9483 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CjaGPx02
start..stop
S start..stop
PtroGPx02 389 4e-141 1..190 1..190
HsGPx02 389 4e-141 1..190 1..190
HlGPx02 389 5e-141 1..190 1..190
PpyGPx02 387 3e-140 1..190 1..190
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..222 222 N° 2 4204..4551 348  
join(1..222,4204..4551)


exon

Literature and cross-references CjaGPx02
Protein sequence: CjaGPx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   190
PWM (Da):   %s   21711.06  
PI (pH):   %s   7.93
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFIAKSFYDLSAISLDGEKVDFNTFRGRAVLIENVASL*GTTTRDFTQLNELQCRFPRRLVVLGFPCNQFGHQENCQNEEILNSLKYVRPGGGYQPTFTLVQKCEVNGQNEHPVFAYLKDKLPYPYDDPFSLMTDPKFIIWSPVRRSDVAWNFEKFLIGPEGEPFRRYSRTFPTINIEPDIKRLLKVAI

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 10, 1 intron). EST ? posn 40 : stop codon
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCATTGCCAAGTCCTTCTACGACCTCAGTGCCATCAGCCTGGATGGGGAGAAGGTAGATTTCAATACGTTCCGGGGCAGGGCTGTGCTGATAGAGAATGTGGCTTCGCTCTGA
GGCACAACCACCCGGGACTTCACCCAGCTCAACGAGCTGCAATGTCGCTTTCCTCGGCGCTTGGTGGTCCTTGGCTTCCCTTGCAACCAATTTGGACATCAG
GTGAGGGGTCCCTCCTTG
TAATGCACCAAAGGTGTTGGATTGGTGTAGCTCAAGGGGGATAAAGGGAGAGGCTGAATGACTGTGTGTTGGAGTGTCTGGAATCATGGGGTATATTTTGTTAAGCTAGTTCTTTAGGTA
CACCTGACATACTAAGGGGAGGTATATATTTTTTAAGATTAAAGGCTGAGGCTGTGTGGTTTTTATCTTTTATTGTCTTCCTACTATATTACTCCATGAGAGCTGGAAGCAGGTCTGTGT
TTCCACTGTGTCCTCAGTTCCTAGGGCAGAAAGCACTCATTAAATATTTGTTGAATAAATGAGTGGAGGAAATAGAGGCCAAGAATCAAACAAGCATTGGACAGACTCAAGAGACCTCCA
GCTCTAGCTGGACTTGGTTTTGCTATTTAATGGCTCTGTGCCCTCACAAAGGGAGCCTGATTTTTCAGTTTAGTTTCCTCATCTGTAAACTGGGGATAATACCACTTAGCTCATAGGATT
GTTATGGTGTTTAAGGGATAGAATATACAAAAATAACTTGAAAAATATAAAGTACTATGCAAATGCAAGCAAACTGATTATTTAGATTGAAGATTATTTTTTTGGTTGAAATTAGCTAAG
TGGGAAGAGAACAAGTGGGAAAGAGAAAGGTTTGCAACATGCATGGGTCTCCTCTGGGCATCACAGTCACCTCTATTTCTGATTAATGGGTCAAGTTGTTATAGATCTTTGGTCCACACA
CCTCGAGTTCTCTTTTAGGGATTCTTCTATTTTCACTTATGATTTTTTTTTTTTTTTTGAGATGGAATCTTACCCTTGCCCAGGCTGGAGTACAGTAGCACAATCTTGGCTCACTGCAAC
CTCTGCCTCCCAGGTTCAAGCAATTCTCCTGCTTCAGCCTCCTAAGTAGCTGGGACTACAAGCATGTGCTACCATGCCTGGCTAATTTTTGTATTTTTTAGTGGAAATGGGGTTTCACCA
TATTGGACAGGCTGGTCTTGAACTCCTGACTTTGTGATCTGCCTGCCTCGCCCTCCCAAAGTGCTGGGATTACAAGCATGAGCCACTGTGCCTGGTCTGATTTTTTTTTTTTTTAAATGG
AGTCTTTCTCTGTCACCAGGCTGGAGTGCAGTGGCACAATCTCGGCTCACTGCAACCTCCACCTCCTGGATTCAAGCAATTCTGCCTCAGCCTCCCGGGTAGCTGGGACTACAGGCGCGT
GCCACCAAGCCCAGCTAATTTTTGTATTTTTAGTAGAGACAGGATGGTCTCAATCTCTTGACTTCATGATTCGCTCACCTCAGCCTCCCAAACTGCTGGGATTACAGGCGTGGGCCACTG
CACCTGGCCTCCACTTATGATTTTAATGTACAAGCAGACAGAATAAACTCAAGTGAAGCCTCTCATCATATTCCCCTTAGTCAATTCACAGTGGTACGAAGGCAAGGAAAAGACATAAGC
AGGAAGTTTGAAGCATCACTGACTGTGACGAACCTGAACCCAAACTGTTCCCTGCTCTCACTGTTCTTCCCTAAGTTTTCTGTCTGGCCTTTTCCAGAGCAGGAGAGACAGAAATGACAG
ATCCTCTTTTGAGATGTCCCTCTGTCTCTAGAAGTACCTCCAGCCTCACCCGATGTCCCTCTGGCCCTAGAAGTACCTCCTGCCTCACACCATCACTTCAGCCTAGCAAGTTGCTGGAGG
GAGTCTATAACTACCATGAGCCAACCAGCTATTTGCATTCAGAAATAGAAATCTGCCAGGGTGCAGTGGCTCACACCTGTAAGTCCAGCACTTTGGGAGGCTAAGGTGGGCAGACTGTTT
GAGCCCAGGAGTAAAAGATTAGCCTGGGCTGGAATACTATGTAGCCATCAAAAACGATGAGTGTTCTTTGTAGGGACATGGATGAACCTGGAAACCATCATTCTCAGCAAACTGACACAA
GAACAGAAAATCGAACACCGCATGTTCTCACTCATAGGTGGGTGTTGAACAATGAGAACACATGGACACAGGGAGGGGAGCATCACACACTGGGGTCTGTAGGGGGTAATTAGGGGAGGG
ACAGCGGAGGGTGGGGGGAAGGTTGGGGATGATTCCCCCGGCTAGAGTGCAGTGGTGTCATCTTGGCTCATTGCAACTTCAACCTCCCGAGATTCAAGCAATTCTCCCACCTTAGGCTTC
CAAGTAGCTTGGNNNNNNNNNNAGGCCCAGGAAGTAAAAAGATTAGGCCGGGGCTGGAATACTATGTAGCCATCAAAAACGATGGAGTGTTCTTGGTAGGGACATTGATGAACCTGGAAA
CCATCATTTTCCAGCAACTGACACAAGAACAGAAAATCGAACACCGCATGTTCCTCACTCATAGGTGGGTGTTGAACAATGAGAACACATGGACACAGGGAGGGGAGCATCACACACTGG
GGTCTGTAGGGGGTAAATAGGGGAGGGACAGCGGAGGGTGGGGAGTTGGGGAGAGATAGCATGGGGAGAAATGCCAGTTATAGGTGATGGGGAGGAAGGCAGCACAGCACACTGCCATGT
GTGTACTTATGCAACAATCTTGCATGTTCTTCACATGTACCCCAAAACCTAAAATGCAATAAAAAAAATTGAGAAAAAGAAAAAAAAAAGATTAGCCTGGGCAACATAGTGAAACTTTGT
CTCTACAAAAAATGCAAAAATTAGCTAGGCGTGGTGGCATTTGCCTGTAGTCTCAGCTACTTAGGAGGCTGAAGTGGGAGGAGAGCTTGAGCCTGGGAAGTCAAGGCTGCAGTGAGTGGA
TTGTGCCACTGCACCCCAGCCTAGGTGTCAGAGTAAGGCGCTGTTTCAGGGAAAAAAAAACAAAAACAAAACAAAAACAGAGAAGTCTACTAGAGATCAGCTCTGGGCTCATTATGTCAT
GATGGCCTAAACTAGTTAGTCCTCACAGGTCAGAAGCAGGAACTCTCTCCCAGAGGAAGATATCTGAATCTTATATTGGAAAGGCAGAGGGGAAGAGAAGGGTTCCCATGGCGTTTTGGG
TTGTCATGAGTGGGAATGCTGAGAGGGAATAGGACAAGGATGGCAGTGGGGAGGGAAAGGCAGGGACCAGGTTTTGAGCCAAAGCAATCGTAGCTGAGAGCAGTGAGTGGCTACGAGGTG
CAGCAGTCTTTGGGTAGTAGCCTAGTCATGAAAAGAATGAGAATTACATACCACCTTTAGCCATCAAGCACTTATTTCCTCAACTTCCCCTCCCCTGGCTTATTCCCGAACCCTAAATCC
TGTATCCTATTTAGTTCACTCCTGTTGCTTACTAAGTAGTTCTATTTAGAGTACACATTCATTGTGGCCTTTAACTTGCTCTGCTGTTATGGCACCTGAAAACTAGATGTCCTTGAATGC
GGTCTTCCTTCATCAAAGCTTCTTCGCGTTTGTACTTCAGTTCTAGGACAAGGCAAGAAGCAAGCAAGAAGCTGCAAATCCCATTCCTCTGGGCCTCAATTTCACCCTCAGTTCAAGTAG
CTGAGTAGGCAGAGGCAAAGGCTACACTCAACACACGTGCAATTGAAAGCAGGCAAGGCAAAACCCAGGGAAGAGGGAAAGGGAAGGGGTGTGTGTGTAGGTGTGGACTTGTGGGTAGGT
AGGTCAGTAGGTTAGTTGAAGAGGAGGTTCTAAGCAGTATAACCTAAGCCTCGTTCTCCTTTCTTCTGCTTCAAACACCTTAAGAACTGCTCAGGGTAGACTGGAGACAAAAGCAACAGC
TCAGAAGTGCTAAATCTTTTAAAAAGCAGCCAAAGCATGGGCAACAAAAGTGAGACCCCATCTCTACCAAAAAAAAAATTATCTGGGCATGGTGGCCCAGAGAGACACACCTTGTCTGTC
TCTCTCCTCACAGTGAAAAAGAATGATCCTGTGAAGGGAGTGTAGGAGGGTGAAAGAATTTCATGATGGGGATCCTTCTTTTCCCCTTTCCCTTGTCCACTCTTTGTCTTTTTCCTCCCC
TAGGAGAATTGTCAGAATGAGGAGATCCTGAACAGTCTCAAGTATGTCCGCCCTGGGGGTGGATACCAGCCCACCTTCACCCTTGTCCAAAAATGTGAGGTGAATGGGCAGAACGAGCAT
CCTGTCTTCGCCTATCTGAAGGACAAGCTCCCCTACCCTTATGATGACCCCTTTTCCCTCATGACCGATCCCAAGTTCATCATTTGGAGCCCTGTGCGCCGCTCAGATGTGGCCTGGAAC
TTTGAGAAATTCCTCATAGGGCCGGAGGGAGAGCCCTTCCGACGCTACAGCCGCACCTTCCCAACCATCAACATTGAGCCTGACATCAAGCGCCTCCTTAAAGTGGCCATA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCATTGCCAAGTCCTTCTACGACCTCAGTGCCATCAGCCTGGATGGGGAGAAGGTAGATTTCAATACGTTCCGGGGCAGGGCTGTGCTGATAGAGAATGTGGCTTCGCTCTGA
GGCACAACCACCCGGGACTTCACCCAGCTCAACGAGCTGCAATGTCGCTTTCCTCGGCGCTTGGTGGTCCTTGGCTTCCCTTGCAACCAATTTGGACATCAG
GAGAATTGTCAGAATGAG
GAGATCCTGAACAGTCTCAAGTATGTCCGCCCTGGGGGTGGATACCAGCCCACCTTCACCCTTGTCCAAAAATGTGAGGTGAATGGGCAGAACGAGCATCCTGTCTTCGCCTATCTGAAG
GACAAGCTCCCCTACCCTTATGATGACCCCTTTTCCCTCATGACCGATCCCAAGTTCATCATTTGGAGCCCTGTGCGCCGCTCAGATGTGGCCTGGAACTTTGAGAAATTCCTCATAGGG
CCGGAGGGAGAGCCCTTCCGACGCTACAGCCGCACCTTCCCAACCATCAACATTGAGCCTGACATCAAGCGCCTCCTTAAAGTGGCCATA

Retrieve as FASTA