Entry information : Ggo2CysPrx02
Entry ID 7645
Creation 2010-10-21 (Myriam Duval)
Last sequence changes 2010-10-27 (Myriam Duval)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2011-07-25 (Catherine Mathe)
Peroxidase information: Ggo2CysPrx02
Name Ggo2CysPrx02
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Metazoa Chordata Mammalia Hominidae Gorilla
Organism Gorilla gorilla    [TaxId: 9593 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Ggo2CysPrx02
start..stop
S start..stop
Ptro2CysPrx02-1 407 5e-148 1..198 1..198
Mmul2CysPrx02 407 5e-148 1..198 1..198
Mfa2CysPrx02 407 5e-148 1..198 1..198
Hs2CysPrx02 407 5e-148 1..198 1..198
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..103 103 N° 2 193..346 154 N° 3 959..1081 123 N° 4 1269..1399 131
N° 5 2441..2526 86  
join(1..103,193..346,959..1081,1269..1399,2441..2526)


exon

Literature and cross-references Ggo2CysPrx02
DNA ref. GenBank:   CABD02173999.1 (14620..16195) [5' end]   CABD02173996.1 (1..576) [3' end]
Protein sequence: Ggo2CysPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   198
PWM (Da):   %s   21764.2  
PI (pH):   %s   5.36
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 19, 4 introns) The last exon is on another contig : not the true place. PArt of the intron 4 is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCGGTAACGCGCGCATCGGAAAGCCAGCCCCTGACTTCAAGGCCACAGCGGTGGTTGATGGCGCCTTCAAAGAGGTGAAGCTGTCGGACTACAAAGGTGAGCGCCGCCCGGAT
GGGGCCCAGGTAGAAGCGGGGCCGTGCATGAGAGAAGCTGGGCCCTAACTCCTCTGTGTCCCTCCTCCCCAGGGAAGTACGTGGTCCTCTTTTTCTACCCTCTGGACTTCACTTTTGTGT
GCCCCACCGAGATCATCGCGTTCAGCAACCGTGCCGAGGACTTCCGCAAACTGGGCTGTGAAGTGCTGGGCGTCTCGGTGGACTCTCAGTTCACCCACCTGGCTTG
GTATGAGCAGGGGC
CAAAGAGGGAGGTTGCAGCTAAGCTCACACCCTCGGGTCCCAGCTGTGTGGCTTCGTGGCCATTGCTCAACCTCTGGAACCTGCGTTTCCCCATCGTGAAAATAATGGAAACATTGCCGC
CCAAGTCTTTAAGGATGATGACAGTAATTAGCATTTGACAACTAGTTGCCTGGCATATAGAGTTGCAGATGCAACTCAGATGCAACTCTACTCTATCTACTTAGTTCCCAGGAGGGAGGC
TGTGCTGCCCTATTTCATAAAGATGGAAACTCCAGTTCACCGAAGTGAAGGGCTGTACCCCATGACACAGCTAGAGGAGGATGGGGACTCTTAACACGGGCTCTCTGCTGGGTGATGCTG
CAAGTTACAAGCACATGTGAAGCCACTTAGCTGGAGCTGTGCCTCTCAAACTCAGTCTTCCCAGCTGTGGGGATAGAGTCCTTGCACCCAACCCAGGGTGGGGTGGGTGAGGCTCCCAGC
AGCCTACTCTAAAGCCCCTTATCTCCGGCCTCCAGTGCTTATCACATTGGGCCCACAGGGTGAGGACCCTGCTGTGCCAGGCATCTTGAGGCCCCAACTCTGTCTCCCCTACTCCCAGGA
TCAACACCCCCCGGAAAGAGGGAGGCTTGGGCCCCCTGAACATCCCCCTGCTTGCTGACGTGACCAGACGCTTGTCTGAGGATTACGGCGTGCTGAAAACAGATGAGGGCATTGCCTACA
G
GTACTGTGGGACCCTCAGCCCGGCTCAGGGAGCGCCCTGCCCCCCTTTCCTGTGATGCTGGGACCACTCCTGTACAATGTCTTCTCTGCCCCCAGCCCTGTGGCTAGCAGCGGGTGGTT
GGTAGTCCCTTCCTTGTCTCTGGCAGTGGGAGCTACCAGCTCCTCACTGGGAACCCTGATGTCTTCAGGGGCCTCTTTATCATCGATGGCAAGGGTGTCCTTCGCCAGATCACTGTTAAT
GATTTGCCTGTGGGACGCTCCGTGGATGAGGCTCTGCGGCTGGTCCAGGCCTTCCAGTACACAGACGAGCATGGGGAAG
GTGAGCAGATACACACATGACACATGGGTACATACTGAGCA
CCTCCGTCACTCATGCAAACATTCACTGCCTGTCCTCTTACCTGTCCAGATGGGTGTTAGGGCCCCCAAAGAAGATTCAGCTCAGGGCTTTGTCTGCAGGATGTTTCTAATGTGGTAGGA
GACAAATAACGCCTGACATTCAACCAAGGTGGACAAAGGGGCCGGGCTCAGTGGCTCATGGTTGTAATGCCAGCACTTTGGGAAGCTGTGGCAGGTGGATCACCTGAGGTCAGGAGTTCG
AGACCAGCCTGACCAACATGGTGAAACCCCGTCTCCACTAAGAACACAAAAAATTAGCTGGGCGTGGTGGTGCACACTTGTAATCCCAGCTACTTGAGAGACTGAGGCAGGAGTTCGCTT
GAACCCAGGAGGCAGAGGTTGCAGTGAGCTGAGATCGCACCGTTGTACTCCAGCTTGGGCAACAGAGCAAAACTCAGTCTCAAAAAAAAAAAAAAAANNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNAAAGAAAGAAAGAAAAAAGAAGAAAAGAAAAAGAGAAAATACTGAACTTGGCTAGGCATGGTGGCTCACACCTGTAATCCCAGCACTTTGGGA
GGCCAAGACAGGCAGATGACTTGAGGTCAGGAGTTCGAGACAAGCGTGACTAACATGGTCTCTACCAAAAATACAAAAATTAGCCAGGCGTGGTGGTGCACCCCTGTAATTCCAGCTACT
TGGGAGTCTGGGGCATGAGAATCGCTTGAACCCAGGAGGGAGAGGTTGCATGAGCTCAGATCATGCTACTGTACTTCAGCCTGGGCAACAGAGCAAGACTCTGTCTCAAAAAAAGAAAAA
AAAAATACTGAACTGGGCTTGGAGGGCTTATCTTAATATCCACATTCCTGGGCCTGGACCACTTGCTTCCAGCATTTTCTTCTGCAACACAGGCCCTTGCTTTGCTTCACCTTGAACCTG
GGGCTGTAGCCTTCATGTGCATCCTTGTGTCTTCCCACAGTTTGTCCCGCTGGCTGGAAGCCTGGCAGTGACACGATTAAGCCCAACGTGGATGACAGCAAGGAATATTTCTCCAAACAC
AATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCGGTAACGCGCGCATCGGAAAGCCAGCCCCTGACTTCAAGGCCACAGCGGTGGTTGATGGCGCCTTCAAAGAGGTGAAGCTGTCGGACTACAAAGGGAAGTACGTGGTCCTC
TTTTTCTACCCTCTGGACTTCACTTTTGTGTGCCCCACCGAGATCATCGCGTTCAGCAACCGTGCCGAGGACTTCCGCAAACTGGGCTGTGAAGTGCTGGGCGTCTCGGTGGACTCTCAG
TTCACCCACCTGGCTTG
GATCAACACCCCCCGGAAAGAGGGAGGCTTGGGCCCCCTGAACATCCCCCTGCTTGCTGACGTGACCAGACGCTTGTCTGAGGATTACGGCGTGCTGAAAACA
GATGAGGGCATTGCCTACAG
GGGCCTCTTTATCATCGATGGCAAGGGTGTCCTTCGCCAGATCACTGTTAATGATTTGCCTGTGGGACGCTCCGTGGATGAGGCTCTGCGGCTGGTCCAG
GCCTTCCAGTACACAGACGAGCATGGGGAAG
TTTGTCCCGCTGGCTGGAAGCCTGGCAGTGACACGATTAAGCCCAACGTGGATGACAGCAAGGAATATTTCTCCAAACACAATTAG

Retrieve as FASTA