Entry information : DerPxd01
Entry ID 7650
Creation 2010-10-22 (Marcel Zamocky)
Last sequence changes 2016-02-17 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-17 (Achraf Jemmat)
Peroxidase information: DerPxd01
Name DerPxd01
Class Peroxidasin    [Orthogroup: Pxd001]
Taxonomy Eukaryota Metazoa Arthropoda Insecta Drosophilidae Drosophila
Organism Drosophila erecta    [TaxId: 7220 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value DerPxd01
start..stop
S start..stop
DmPxd-A 2991 0 17..1526 18..1527
DyaPxd01 2964 0 1..1526 1..1528
DsiPxd01 2945 0 17..1526 18..1528
DmPxd 2880 0 17..1523 18..1526
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2618079..2620728 2650 N° 2 2626307..2626488 182 N° 3 2626794..2626972 179 N° 4 2627083..2627289 207
N° 5 2629144..2629809 666 N° 6 2629986..2630227 242 N° 7 2630316..2630387 72 N° 8 2630473..2630688 216
N° 9 2647781..2647947 167  
join(2618079..2620728,2626307..2626488,2626794..2626972,2627083..2627289,2629144 ..2629809,2629986..2630227,2630316..2630387,2630473..2630688,2647781..2647947)


exon

Literature and cross-references DerPxd01
Literature Drosophila 12 genomes consortium (2007) Evolution of genes and genomes on the Drosophila phylogeny. Nature 450:203-218.
Protein ref. UniProtKB:   B3NBK0
DNA ref. GenBank:   CH954178.1 (2647947..2618079)
mRNA ref. GenBank:   XM_001971260.1
EST ref. GenBank:   EB542694.1 [5' end]
Protein sequence: DerPxd01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   1526 (1504)
PWM (Da):   %s   170324.35 (168009.9)  
PI (pH):   %s   6.13 (6.08) Peptide Signal:   %s   cut: 23 range:23-1526
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRVPLLLLQLLGLLLLSGGVQSTYCPAGCTCLQRTVRCIRAKLTAVPKLPQDAQTV*VLNGPKILAIYFNSLVYMSGLKTQQCIWIRSIIK*LKKSSNWKNFYGAP*FS*VP*VQNALFMLLIFLSKFGFQFPFVECT*INAGVGLQIHKLVFNVFCARCEKLTALI*RPFFCSSFRGGVLLLRLLLLLLLPGSPLLLRNP*MFRQAALC*LN*TDV*PAKADCDLYIYHAACRVFACMCNISDVAFIFENVSSFRMNFGHHNHSASNAYNLANVCEAYAYLCRPWRVSSRRNNLATRQNAPAAAADGKLSSDRKTVSTGGQQDIRTDGARFSWYLRRIQFPAGLSRV*WQGFADSPPRISTTRQSGANAILVLGIGEATQFTCQRMRKP*TNRLYGALKTIKCSRLGSIIR*FAIRRF*STFMFNLIHFKFGKSDHRELFDNSTFLRWKKEI*IA*LNYAARKKMFHF*NS*QVDKFHLSVEWVKPITAAVIEFGVPKYEDLLFHLS*WTGA*LVAIERDCSFGILKTASAFK*IFHFVK*RRTKRNK*VVLDYEFKPARQVTKA*MVGKNKILKLKNNMKPKTFLTTAELIIELTNISGQSKTMCNQQQCLSYLNILLYNPLRHRIHSHLAISPGGSHSLPFAICLARRTTISQMGESCGKLLVGANSIWQYLN*SSF*IR*WLHNLSCLESNSSRTQQ*KKIWKTLKNTEKDQKESNF*VAIAIRFSFITQPTRCTLLINLFHLLQHVSKSCSCFPP*SCTCALVHFAFV*GCRLRFQLSFHNSRNVSRQSMKNMSTHFPSQRHYHFIAHTCPHFVSLSVKIFLI*FP*WRKFCLQFLSEGH*R*MSSKHKRNDVKLVKTEQF*QR*KQRQFLVKLYKEFRRCSPGQTGSSLSMPQRAAGMMRVVPSLRWQGVRRTTTRTRTRTRSTRTPLDSRQSHVCRSCRGMQPF*LFPYLYCCTTTTPTDSF*LVALIKYANLGDGFSVGLEKLEIGSVKKERSETFLRCQEFFFRWQPKSMQCKFRCLLFFQRPFCSRA*VPL*VCVCMCVRVCECVCDGSEFSARGLTFAACSHTHSKSVRAIVMRPLDYRHWQITWATRRHTGYLAARM*VLACKDAPASPVQALLFLWLLLLAMLLLLFVLLPACL*AMLLQ*CAI*V*DGALKEMSMSKMNGLKWVPLIGAPKILQASKPIEKYLKFEIWKQLLSSFQPPEV*RN*VRQDAMRMHP*TYSIFSLCWRMRSLWWLGADESVSVSVRQAKVKSCFYCHICHKGSRGTGRP*KDLYWLRSRSGSRC*CH**GSA*VALFFLSPTVMALFTLHTLWRKAVLAGGRRGGGKGVCAKRGKSEALELTLMKMQ*TGKYTDCMIKTN*RKSKRLV*KSSDRTISEAIIFTNR*P**NCEIPVD*NSSVISLNNRSRGKIIKLKSQKGTPQTYTCRNCMAPLEFRLYPQEIRN*FTCCGFSFTNCDRLNNEVWSPDVCTKCNCFHGQVNCLRERCGEVSCPPGVDPLTPPEACCPHCPMVK

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns) and 1 EST. Strain="TSC#14021-0224.01"
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGAGTTCCGCTGCTGCTGCTGCAGCTGCTGGGGCTGCTCCTCCTCTCCGGCGGAGTCCAGTCCACCTACTGCCCAGCCGGATGCACCTGCTTGCAGCGAACTGTGCGCTGCATCCGC
GCCAAGCTGACCGCCGTGCCCAAGCTGCCCCAGGATGCCCAAACGGTGTAAGTACTCAATGGACCTAAGATCCTCGCTATTTATTTCAATTCACTCGTATATATGTCGGGCTTAAAAACT
CAACAATGTATATGGATTCGTTCAATAATTAAATAACTAAAAAAATCAAGCAATTGGAAGAACTTTTATGGCGCACCTTGATTTTCCTAAGTTCCTTAAGTTCAAAATGCACTTTTTATG
CTTTTAATATTCTTGTCCAAGTTTGGCTTCCAGTTTCCTTTCGTCGAGTGTACATAAATCAACGCGGGAGTTGGCTTGCAAATCCATAAATTAGTTTTTAATGTTTTCTGTGCACGCTGC
GAAAAGTTGACGGCGTTAATTTGACGCCCCTTTTTCTGCTCCTCCTTCCGTGGAGGAGTCCTCCTCCTACGACTGCTGCTCCTCCTCCTCCTCCCAGGGAGCCCCCTGCTCCTGCGGAAT
CCATGAATGTTCCGCCAAGCTGCGCTATGTTGACTCAATTAAACGGATGTCTAACCGGCAAAAGCTGACTGCGATTTGTATATTTATCACGCTGCCTGTCGCGTATTTGCATGCATGTGC
AATATTTCTGACGTTGCATTTATTTTCGAAAATGTCAGCAGTTTTCGCATGAATTTTGGGCACCACAACCATTCCGCATCCAACGCATACAACTTGGCAAATGTTTGCGAAGCATATGCA
TATTTATGTAGGCCGTGGCGTGTTTCAAGCCGGAGGAACAACCTCGCAACCCGGCAGAATGCACCAGCTGCTGCAGCCGATGGCAAGTTATCATCAGACAGAAAAACAGTCTCCACTGGG
GGACAACAAGATATCCGGACAGACGGAGCACGGTTTTCGTGGTATTTACGGAGAATTCAATTTCCAGCGGGGTTGAGCCGCGTTTGATGGCAGGGATTCGCTGATTCTCCGCCAAGGATT
TCCACAACACGCCAGTCAGGTGCAAATGCCATCCTGGTCCTGGGAATAGGTGAAGCCACTCAGTTCACGTGTCAACGAATGCGAAAGCCCTGAACAAATCGATTATATGGTGCTTTAAAA
ACTATAAAGTGCTCTCGACTGGGGAGCATTATTCGCTGATTCGCTATTCGCCGTTTCTGAAGCACTTTCATGTTTAATCTGATACATTTTAAGTTTGGAAAGAGCGATCATAGAGAATTA
TTTGATAATTCAACGTTCCTGAGGTGGAAAAAGGAGATTTAAATTGCTTGATTAAATTATGCGGCCCGAAAGAAAATGTTTCATTTTTAAAACTCCTGACAGGTGGATAAATTCCACCTG
TCCGTTGAATGGGTGAAACCAATTACTGCAGCTGTCATCGAATTTGGGGTCCCCAAATATGAGGATTTATTATTTCATTTATCGTAGTGGACTGGGGCTTAGCTGGTCGCCATTGAAAGA
GATTGTTCATTTGGCATTTTAAAGACTGCATCTGCATTTAAATAAATATTTCATTTCGTTAAGTAGCGTCGAACAAAACGAAATAAATAGGTGGTATTAGATTATGAATTTAAGCCCGCT
CGACAGGTGACAAAAGCATGAATGGTTGGCAAAAACAAAATTCTAAAACTGAAAAATAACATGAAGCCAAAAACTTTTCTGACCACAGCAGAATTAATAATTGAGTTAACCAACATATCA
GGCCAAAGCAAAACTATGTGCAACCAACAACAATGCCTTTCATATTTAAATATTCTATTGTACAATCCACTCCGCCATCGAATCCACAGCCATTTGGCAATCTCACCAGGAGGATCACAT
TCTTTGCCATTTGCCATTTGTTTGGCTCGCCGCACAACAATTTCTCAAATGGGAGAAAGCTGTGGAAAACTGTTAGTGGGAGCCAACAGCATTTGGCAGTACTTAAATTAATCTTCATTT
TAAATAAGGTGATGGCTGCATAATTTATCATGCCTCGAGAGCAACAGCAGCCGCACACAACAATAGAAAAAAATCTGGAAAACACTGAAAAACACAGAAAAAGACCAAAAAGAGAGCAAC
TTTTAGGTTGCCATTGCGATTCGCTTTTCATTTATTACCCAGCCGACCCGTTGCACACTTTTAATTAATTTGTTTCATTTATTACAGCATGTGTCTAAAAGTTGCTCTTGTTTTCCCCCA
TAGTCATGCACTTGTGCACTTGTGCATTTCGCTTTTGTCTGAGGCTGTCGACTCAGATTCCAGCTTTCTTTCCATAATTCTCGAAATGTTTCTCGGCAGTCTATGAAAAATATGAGCACA
CATTTTCCCAGCCAGAGACACTATCATTTTATAGCTCACACATGCCCACATTTCGTTTCACTCTCCGTGAAAATATTCTTGATTTAATTTCCTTAATGGCGAAAATTCTGTTTACAATTT
CTGTCGGAAGGTCACTGAAGATAAATGTCGAGCAAACATAAAAGAAACGACGTCAAATTGGTAAAAACAGAACAATTTTAGCAGCGTTAAAAGCAAAGGCAATTTCTAGTTAAATTATAC
AAAGAATTTA
AGTCAAAAAGGCAAAAAAGATGCTCCTAGTCAAATAGGTGCACAAGCATTCTTAAGAAAATATTAAAATATTGCATAGTAAGCTCGATATGCATAATGATCTCGAAGATC
AGCTCCTAGAGGTTTCCATTCAATGGTTTCCATTCCCGGCCAACTTACAAAAGCCTTTTCAGTGAGTTCGCTTCTATTTCGCACACTTCAGCTGCCATTCCTCTTCAATTTGCTGCAGCT
ACAGCCTTCTCAAGCCTAAGCCACATTTCACTTCTTTCAAACTGTCCATCCATCAGGCATAAAGTCGCCGCCTTCGCAGCCATTGAAAGTTCTCGCCGGGATGGGGCCATAAAAAATGGG
TGCAGCAGCTCCACATCCACGAAACATCCCTTTTCACATCCTTGACTTGCCTCGAACAAAGGCCCAAAATTCTTTTTGGCCCAGACCCGTGTGTATTTAAACTGGCAACTAAATGGAAGT
CGCAACTGTGTAACATACGGCATCATTCATCTTGCCACGCCCCCATGCCCCACGCCGCCAACCGCCCACTCACATGGCAGCTGGCAAGGGCGGGGGGAGGAGCTAAATAAATGCACTTGA
TTTCATTTCATGATGATGCATTTTTAGCTGACCTCCCATAAAGCACACATCTCGACTTGCTCCGCCGTGGAGGCAGTTGCTTTGTCATTATACCCGGGATCGAGGAGCTCGCCCAGTGGA
TTTGGCCCATCCATTCCGGACTCGTGAGCCGGTACTTACTTTTAAGGAGCGAGAAAAATTGCTTTTCGATGCGAGAAAATGTGGTGAGGTTGAAAGTTTTGACCCAGGCAAGCTATATTA
GATTTAAAACAATTCGGCTGTTTTTATCTATAAAAAGTATTAAGTCTTTAAAGAAAGCTAAAAGGAACATGATAATATAATAATAATAATAATATAAATAGAGAATTTTCCTTCTTTTCC
TTGCCCCCTTTTCGCTCACTGTAGCCTGAGTTGAAAAGACGAGCACATAAAACGCACATGTAGCCAAGACATATGAACTAAATCTGCTCGCCGGCGGCAACTCTGCCACACATGCCATCA
TCTAATAACTCGGGCATTATGCACATATCAAATATATCTCATAATGCCGCACCGACTTGCCACGCCCCCCCAATGAACGCCGCCCGCTGCCGCCCACTTTGCGGCGGTGTGTCAAAACAA
AAGTCGCCGCACGTTGCATGCAGGGCATATTAAAAAGTTTGATTAGCGTCCAGTTCGCTGGCTCTGCCACGCCCACCCCCGCCCACTGTCCGACAATACACACACACACACATATGCCCA
CGAACATGAGTATGAATACATATACATATATGGACAATATTTGGCTCGGGTTTTTTTGTGAATCAACTATTTGCGAAAACTATTTGGCTAGCAAAAATGTAGCAAGTTCCCTGTTGCTCC
TGCTGCTATTTTGTTTCGGCCCCCAAATCATCCGCCCGCTTTAGGCCCCCCACATATATAGATATATATATATACAATATGTAGGGACAGGCCCCCGGAAAAGCCCGATTTTGCCATCAT
ACTTTCCTGAATTTCTCATCTCGTCGGGTGCATTTATGCGTGAGAAATGCCTTGTATTTTGTAGCTGGTCGTCGTTGGCATATCCTTGTTCCTGTTCCATATCCAGTTGCTCCTGCCATG
TTGTTATTAAATATGCATAAATTTCCTTTTTGCACAGGACTTTTGCATTTACATTTGCTGTTTATTTGTCGGTGGGAATATTGAAATTGTTACCAATGGATAGCAGATTCCAGCCCAGAG
AACTTGTTTCCGGTGGGCCGCATGGAGTCGCATCTCCGGACGCAGGTGTGGATGCACCCCCTCCAGTCAGTCGGGCGGAGGTGGGAGTTGGAGGACTATATATGTACATAGATCTATCTT
TCTGAGAATATATGCAGGATATGCAGCCTGGATGCGGATAATTATAATTAAAGGAGCCGGCAAGTTGTCGGTTCAGGTTTCTGACCGATTTGTGAGGACTTCGCTCCGTTTGTGTCGAAT
TATGTTCCATTGCAAATATCTTACTAATGAGATTGATTATTATTAACTAGTAGGCTTTCACCATTTCCTCACAATCTCTGTGTATTTGCAAATTATTTCTATATATTTTATGCAGTTTCT
AATGAGTTATGGGCAGCTTATTGTCTGCTGCAGAATTTTAAAGTATATGTTTCATTTAGACCACAGTTAGATAAATCAAATTTATTAAATGCTGTTTATTTCCTCTAGCCAAATAATTAT
TATTAATTGGTAAAGATGTTTTTGTGGAATGCTCAATTCAGTGAATTTGTGACTATTAAAAAATAATTAATGACATTTATCGCTCTATGCAGCGTTTAATTAAAATGTGTCGTAATCAAA
CAATATTCTTAGTAATAACAACACATTAGATGTGTGTACAAAAGAAAATTCAGACAATAATGATAGTGATAGTGAAAGTGGTATAATGTTAAAGTAATTATAACAAACATAAATAATATT
TTACATAATTTCTTGGTGAATTAAATAAAGGGAATTAATTGAAACTTATCCCGGTTTAATGAAGTTCTATTTAAAATGATTATACCGATTAGAAAAAATATGCGTCCCATTTAAGTTTGT
TATTTTAATTACGCACCTCCATTGGATTTAATTTCCTTAAGTGGCAAGCTGTTGAAAAACTCATTCTGCTAAAATCGCAGTGCCATCAATCAAAGCTGTCTGCGTTTGCCTAGTGATAAA
TCCTCTAAATGCATTCCGAATCCAATTACCAATCAATCAAAGAGCATCCAATCGTCGCTGTCTCATCCGTCTGCTTTTATGTAGACTGCCACGCCCCCCCAAAAAGCTCTGCCCTCTTTG
TGAAATATAATATTATTGTTGTTACGGTTTTTGCCCTTGCGCTGCAGTCTGGTTTGACTTTTCAATTGTTGCCATATTTTTGCAGATCAAAAAAAAAGGGGAATACATGGAAATAAAATT
AAATTGCGTATGTGAACAATATGAATGGAATTCTTACCATTCCGCCACCCAATCAGTAATATGATTTGTAATTATGCAAATGAAGCGGTAGACCAGCGAACCCAATTGAATGGGCGATGC
AGTTTTCATTGATTAAAGCTGAACGTTTGGGCAATATTCAGTTTTTACATGGCAAACCTCAAAGGGAAAACCCCGAAGGCAAAGTTTTTGCCAATCAAAGCGTATGCATTTTTAATTCAC
TGTCACAGGCAGAAGTGGAAATGGAGCTGCAAAGTCGAGTGGCGTCTCGGGTGGCGGATCCCCGATTCGAGATTCAAGATTCGAGATTCCAGGCCCAGGACTCGAGGTTCGAGGCTGGGG
ACTCGAGATTACAGATTCCGCCAAGGAATCTGTCTGCCAGTCAGCCAGGCATCGCTCCAGCTTCACTTTGACATAGAAAAATCTTCTATTGATTTCCCAAAACTCCCCCTCAATTTGCAT
TTAAAGTTGCCCGCTTCCCTTTCTTTCATCTCTCACTCGCGCCCCTCTTTAATGCTACAAAGTGCCACTTGGTTCATTTGCCAGCAGTTCTCCTGCTCCTTCGGATCACGCCACTGCCCC
TGCAACTGCCACTGCCACGCCCACCAGCTTTGTCATTTCGCATGCTCGTTAGTGCGGAGCAAAGAATGCAAAGTAGCAAGATAGCAAGAGCTGTGTGGAAAATACAGCAGCAGCAACATC
ATCGCTGCACAAACACATGCCACAATTTATAAGCAAAGTTATTCTGCCACCGAGAAACGTAGGGCGGCCATCGGCCGGGGGGCCGGGGGGCGGGGCAGTGGCAACTAGCAACATGTCAAA
GTGGAGCAATCGGCATGTGCAACGGACACAGAACAGGACACTGAACACGGAAAACAGGCGTGCACTGCGGGAAAAATTAGGAAGAAGTTGCGGCTGTCCAAGCCAATATTGAGATGTTGT
GGCTGCCACTAAAGGTTTTCCATCGATGAGTACGATGTTGCAGTCATGAAACTGAATACTTAGAGAACAGGGAGTTTAGTTTTAAAGAAGTCTGCGTTTCTGCAGGAGGGCGAGCTCTTT
AATGTAATTATTTGAAACTCGCATACTAATTCCTCCTTCAATAAAGAAATAATAGAGTTGGGAATAGATTACAGTGCAGTCCTGGCAACTGGCGGTCAAGCATAAGAAACAAGCAGCATC
AGCAGCAGAAGAATTGCAGCCCATAAGTATGCTATGGCAACGGAGCGAAGCCCAAAAGCGAAGGAATAAGAACGCAAATAAAAGCGGTGGATGCGGAAACCCACCTCCTCGACTCCGCCT
GGCCAGGTGAGATGCCACCGCCATGTGGCACGAACTACAGTCAACAGCAGGCGATGGGCGAGCCAAGAAAAAACAGGACAGCCAGCTAGCAGTGTGGCTTAGTTAAATGTTAGTTACCCT
TTCAATGAATCAAATTCAGATTAAATGCTTACTGTTCAAGTCTGCATACCATAAAAAGTCATAGATATTCGGATCAAACATTTCATTTATAAGAAATCAATTAGGCAAAGAGCTTAGCAG
TTTATTAGTAGTCGGCTAGTAGCACAGGACCTCCTCAAAGGGTATTTCCTGGCGCCAAAGGAAAAGAAGCTCCTGGCTCGCTCACTGCTCAACCAGGCGGCAAACCAAGCGAGACCGGGT
TCGGGGTCCAAGGAGTCCAGGTCCGAGCCAAGTGGCACACCACGTAACCAGCAGATAGCAGATACAAGATGGCTGCTCCGGGTACGGAACTTGCCCCACACAGATGCATAATAATGTTAA
TGTAAGCGCCTGCGACTTTGAAGCCACCATGGCGTATGCGTAATATGCAAGCAAATTTGAAGCTATTCTCGGTCGTGTAAGTTGAAGCCGAAACCCCAAAATGAACGTTAAATATTTGGA
AACTGTGTAGTTACTCGACTCAAAATTGAAAATTAGCTTTCAGTTTTAAATAGCATAAAACTAAACAGCTATTATATCCACCTTTGCGCCACACTTGAACAAATTTGATACGTTTAGCAA
TGTTTTGTCATTTCAGTTCCTCTGCATATTTATCAATTTCCATCCACCTCAGCAAAATACATTTATCCCTGGCAAAGCCGAAATAGAACACTGCATCAAAAGGGCTTTGGGTAATATTCG
CCTTTTATACGCATATTAAACCGTTTCCACTTGAATGGCGAACTGATTTCATTGCATTTTTATAACGCACATATATGTACGTGTATGTTGCATGGTCGGTGTGTGGGCTGAGTGTGCCTC
CTCAAATAAAAAGGAAGAGCTGCTCATGCACCCAGCTCCATGCTCGACATATAAATCTGCTGTATAATTGAATTTCACACGTTGCAAGGAAAAAAATAATACCAAAATGGTGCAGAAAAA
ATAAAAAAAAGTGCATATCCAGCGGCAGCGAAAGTTTAAATAAAATTTATTTCAACAAAAATACACACTCGTTGGGCAAATGTGTGGGTGCAGAGATGGCAGTTGCCTGCAAAATGTGAG
CATTTTATATTGAAGGGCGCAGGAGTGGGCAGATGGTGCAGCTCCTCCAGGTGGCCACTTTTAACCATGAAGGTGTTCGCCTGGCCAAACTGGAAGCAGCTTAAGCATGCCACAACGAGC
AGCCGGGATGATGAGGGTGGTTCCCTCATTGCGTTGGCAAGGAGTTCGCAGGACGACAACGAGGACGAGGACGAGGACGAGGAGCACGAGGACTCCCTTAGACAGCCGGCAATCGCATGT
GTGTAGAGTG
CACTTGTGAGACATTTACACCTGTAGAAACGTCGATGGGAGCGGTGGGCGGCACGTTGAGCATTCTGAGCTGGGATATGAGGCACGGCTGAAGGAGCTTTTGAGGCACAA
CACATTAGCAGTCCAACAAAACAGAAGAGCAGTCCTCACGAACCAAAAATTAAACTTCGCAAGACAAAACTACATATTTCGTTTTTGTATATTTAACTTTGTTTAAGAGATGCTTACAAC
ATTTTTAAGGGGCTGTTCTCACGAGTGACAAGAAAACGGAGCAGCTCAGAGTAAAGGTAGAACAACAATAAATTGAGTTGCAGAGGTATGCAACCTTTTTAATTATTTCCCTATTTATAC
TGCTGCACCACAACCACACCCACTGATTCATTTTGATTAGTGGCACTGATAAAATACGCCAATCTTGGTGATGGGTTTTCGGTTGGTCTGGAAAAACTTGAGATCGGGTCGGTCAAAAAA
GAGCGGAGTGAGAC
AGCAATTTTAAGTAAGAGGAAATTTGTAGCCCGGGCACTTCTTTGGCCTTCTAACATTTCGTTTTTTCTATGCTCCGAGGGCTTTTCCACCCTTTTCCTCTCCTTT
TGATTTTCCTCCGCTGTCAGGAGTTTTTCTTTCGGTGGCAGCCCAAAAGTATGCAATGCAAGTTTAGATGCCTCTTGTTCTTTCAGCGTCCTTTTTGCTCGAGAGCGTGAGTGCCACTGT
GAGTGTGTGTGTGTATGTGTGTTCGAGTGTGTGAGTGTGTGTGTGACGGAAGTGAATTTTCTGCACGTGGCTTAACTTTTGCTGCCTGCTC
TGGCGTGTCATGCAGTCAGCAATCTTTAT
CCAACCCAAACCCGAGCAGCTCGAGTGGGCGCCTTTCATTCTTTTCTTGCGGATTTCGCTCAAGGATTGCATTTAACGCAGGAACAGGAAGGAAGGAAATGCCATGTCGACGCTAAAACT
GGGTTAGCTTACATAACGACAACATTAACGACAACGCTTTCCTTCCGGTGGGCGGGGTTCTGTGGGTGGAAAATGGGTAGGATGGCGTTGTCTTCACGCTTCGTCGCTTATTGGACATAA
TTACTGAATATAACAATTCTGTGGTGGCCCCGCAAAATGGGGTGGAAGTCGCATGTGGCACTCGGAAAAATGTGCACCAGGAATTTCGGGAAGCTTCCTATTTGAGAACTATTTCTATCA
TGAGAGTTTGTGAGCATGATCTTCAATCCAAGTTCTAATAATCTCTCCACTGCCAAATTGTTCTTTCAAATCTTTCGGACCTTTGCATTCAAAAGGCGTGCTTGCATACCCTTGGAGCAC
CTTCGATATATTCTTGAGATGCATCCTAGATTTCGCCTAGTGCACATCCTTTCGCCATAGCCACTTGTGCGTAACGGCAGCGCCAGATAAGTGCAACAAAAGCCACGGCGGCGGATGCAG
CCAAGCCAGGCCACATATCAATTCCATGTGAGCGGACTAACTGGTCCTGGTGCAGTCCTGGTTCCGGAATGTCCTGCTTGCTGGTGGTCAGTCGGGGGGTGGGGCGGTTCGGTCGTATCC
CTTATCGCTTACACTTGGCCAAAGGCGAGTCACCCGCACACAGTTCACTAGTGGCACTGGTTTTTTGTTCGCCTGCCAAATCCTTAAAGTAGCGCAGCTTTGGCCCAAGGATTTGTCGAA
GCAAAGTTTCGTTCTTTGTCAGTTGGGGAAAACAATGTTAATTGCTTTGCAGTTTACTTTGCGCAATCCGGTTGACTGACTCAACTGTTGGACTTGTCGGTACGGGCGACATCCGCTAAG
CCGTAAACTGCGGCTCTCAAGTGCTTGGCTCAATGCGTTGAAAGTCCGCTATTAACTTTATGGCTTATAGGAACCTTTCTCCGTACGCAAAACTATTGATTTAATTTTCATTGACGAAGG
ATTCCAATTAGTCTGGAGCTTCCTTTTCAGATGTCATTGCACTATCCGTAGCAGGTAAAATTTATTAAGCCCTACACTCTTCGGCCAAAATCTTTTGTTGTTCCATCTGGGCTAAACAAA
GCGTTTTATGCATGCACACTCCGAGCCAATTACGCAAAGTGCTCTAAGTATCTCAAACAGTCCTAACTGGACACAATTACATTAACAGTTTAGCACACACACACACACACACACACACAC
GTAGCAAGCAGATATCGGGGATTTCCGGAGGATAACGGGTTAGATATAGCCATCGTCAGAAGTGAGCGAAATTGGGGGTAGGCAAACAGGACGAAAATTAAATCACAGCCACAGCTGCAA
AGGCTCGAAAATAAGTCCGGGCGAAAAGGAGCAGAGGCAATGAAACTACTACTGAAACTGCTGCCTCTACGGTAACTAACTTTAACCCCGGAATCTTGTAACCCGTAACGCCCATCTCCA
TTAACCCACACACACACACACACACACAGTCAAAGTGACTGGCTGACTGACAGCTGAACTTTTACGCACACAGATAAACAGTGTCAAGGGTTAACAGCGATGGGCGGTGGGGCGGAGGGG
CGGAGGGGCGGAGGGGCGGAGGGGCGGAGGGGTGGCCTTTGTTAAATAATAATAAAATGTCACTGGGCAAAAATAAACGGCTGAGGAGCCGAGCGGCTGAAGGATTACACTGCCAAGTGC
TCCCCACAAGCACACAGCCACCCACACACACACACAGTAAGTCAGTCAGAGCAATTGTCATGCGTCCTTTGGACTATCGTCACTGGCAAATCACCTGGGCAACCCGACGGCACACAGGAT
ACTTGGCTGCGAGAATGTGAGTCCTGGCATGCAAGGATGCGCCCGCCTCGCCGGTGCAGGCACTTTTATTCCTTTGGTTGTTATTGCTGGCCATGTTGCTGCTGCTATTTGTGCTGCTGC
CGGCGTGTTTGTAAGCCATGTTATTACAATAATGTGCAATCTGAGTCTGAGATGGCGCACTGAAAGAAATGTCTATGAGCAAGATGAATGGTCTCAAGTGGGTGCCTTTAATCGGTGCGC
CTAAGATTCTGCAGGCATCCAAGCCAATTGAAAAGTATCTTAAGTTTGAAATCTGGAAACAGCTCCTTAGCAGCTTCCAACCACCAGAAGTATAACGAAACTAGGTGCGCCAGGATGCGA
TGAGGATGCATCCTTAAACATATAGCATTTTCTCTCTCTGCTGGCGAATGCGGTCCCTGTGGTGGCTCGGTGCGGATGAGAGTGTGAGTGTGAGTGTGCGGCAGGCCAAAGTTAAATCAT
GTTTTTATTGTCACATTTGCCATAAAGGCAGCCGAGGGACCGGCAGACCGTAAAAGGATTTGTACTGGCTCAGGAGCAGGAGCGGGAGCAG
GAGCAGGAGGTGTCATAAGATGCTGCCTA
AGCTGCAGGCGCACGTGGGATGGGCAGGTGGGCAGGTGGGCAGGTGGGTAAGCCAGACAAATCATAATCAGAGCACAAGGCAACAAGCTCAACAAAGCCGGAATCACCTTAACAACCAGG
TGGGCTGCTCTTAGCCGGGTTGCTGGGGTGCTGATGCCACTGATAAGGCAGCGCATAGGTGGCCCTTTTCTTTCTTTCACCCACGGTTATGGCCTTGTTTACGTTGCATACTTTATGGCG
CAAAGCCGTGTTGGCGGGGGGGCGGAGGGGCGGGGGGAAAGGCGTGTGTGCAAAGCGCGGAAAAAGCGAAGCGTTAGAGTTAACTCTAATGAAAATGCAGTGAACTGGAAAATATACTGA
CTGCATGATAAAAACTAACTGACGCTGAA
AGCTGGCAGAAAGCAATTCCAGGGAGAAAATGAAACCCTTAATTTATTTAGAGCCGCCACAAAGGACCAAATCGTTTTTAGAATCAGCAAT
CAAAGCGACTTGTATAAAAGAGTTCGGATCGTACAATTAGTGAGGCTATAATATTCACTAATAGATAAC
TCAGTGTGGATTAAACCGTATTTAATTCGTATTTATTTGTACATTACAAAT
GAGCGTACTTCATGATGTCTGTCATGATTTTTCACTTAGTGAAATTGCGAAATTCCAGTTGACTGAAATTCATCTGTAATAAGCCTCAACAACCGCAGTCGTGGCAAAATAATCAAACTG
AAATCTCAAAAGGGGACACCACAAACATACACTTGCCGAAATTGCATGGCCCCCTTGGAGTTTCGCTTGTACCCCCAGGAAATCCGCAACTAATTTACTTGCTGCGGTTTTTCCTTCACT
AATTGTGACA
ACTAATTGAAATCAAATTAGTGAAGCCACTAAACAGCTTAATGCTCGCTGAGCACGAACCAGATTTTCCACCTCGGCGATGGGAAAATTCGGGGAAGCGGGTGGCCAATG
GGTTAACCATAAACCCCACACAATGCTAATTGTTTTCATTCAATTTACTGTCTGCACGCCGCTTTAAAATATCGCTCTTGGCTTCAGTTTTGGCTAACCATAAATTTTCGTCATGGACAT
CAAAGCGTATACGCAATATGGGTGCGCCAGTGCGTGTGTGTGTGCGTGTGGCATGTCCTGTTTGCAAGAATGTGTGGTGGGTAGTGTGGGTGTGCAGACATGCGTGAATAGACAAACATG
CCTTTGTCAATAATATGCATTAATTAAGTGCAGACATGGATGCCAGAGGAATCAAACCAAGGATATCCGAGGTGCATCAATGGATGCCCAATCCCGCGCCACAGGACACACAGACATACG
TGCATACGTACATACGGACACACTGACACGCAGAACTCACCACCAACAACACTGCGCATTGCAAATTTAATTGAAAATATCGAATAATGCGAAAATGCAAATGTCATTATCAAAATTCAG
GCCGGCGGAAGTGTCACATGCGCTGAAAAGAAGTTTCAAGATTCAATTTCCGTTTCCGCACACATGACGTGCATCGCAGCAGGTGGGTATTAGGGCGTGGCCAGAGGGGGCGTGGCAGAG
GGGGCGGACGAGTGCACCGCCGCACAGCATCCCAGTTATTTATGCCTCCTTTCGAGTCCTTTTTTAGCAGCTCCGTAAATAGTTGCGCAACTGACACGACGCCATCCACGTCTATGAGGC
CATTGCATCGGCACCCCGCTGAATCCCCATTTAGCCAGAGAGCAGCTCCAGCACGCACTTGTGCAGGAGTGGGTTCTGTTCCGGCACATAAACACTGAGCGAAATCGTGGCTAACAACCA
ATTAACATCAACCAATCAAAAGGATGCCTAGCAAAAAGTGGTTAAGAAAAATGCAGTTCAAGGATGATTTTTTGCTTTAAAGTCGCGGGAAGGTGGCATGGCATACTTGCATTTTCTCAC
AGTGCATCACATTTGGGTAGGCTCGATGAGGCATTGGTCTGGGAGTACCGCCTGTCCGGAATCCACAGTCCGAGTCCGGAACCCGGACACGCACTCAGCGTGTGTGCACATTGAAGTGGA
CCATCGTTTGTCACTCGAGGTGGGTGTGGAAGTGGGTGCGGCAGGGGAAGTGGGTGAGGACACGGGCACAGTGGGGCAAAAAAGAGGTGGAGAGGTGTTGGCCATGCAGAAAGAGACTCG
CCAAGTGGCTGGGAATTTTAAAGCACTCTTCGGCTGAGCAAATACGATAGCGGTGTGTGAGTCAAAGGGCACAGAAGACCAGTTCCTTGTTGATTCAAATTAGACCGATCCATCTGGCGG
CACCACCACTCGGCTTGACCCACTGTGAATCTGAATGTGAGTGTGGCTGTGGCTGTGGTTGTGGTGCAGGCTCTGGATGTGGCCGTATTCCTTGTTGACTCCTGGCGGCGGCGGGGCTAA
TGGAGTTTGCAAGAAGTGGGCAAAAATGTGGATCAAGCAGCCGTACATGCACACAAAGACCCACCAATCTTGGTTCTGCATTCTCCGGCGCTCCTTCCTTGCGGGAGAAATGCGAGCAAC
TTTGCAAATTGTTGCCGCCACCCAAATCCCTGCCTGCATATCGCCACTGCCCCACTTCCTTGGACACACCGCTGCTGCATGAGGTTGCCAAGTTGCTCCACAGGAAAAATATTTACCACA
ACTTTAGAGGCACTACAAAAATTCTGAGGATTGCATCTCAATTAACTGAAGTGCTGTTTGGCTATAAAAAAAAACTAGTTTCAGACTTAAGCTTATTAAAAACCAAAAACAAATGAAAAC
AAATTTTGTAGCAGACTTTGAAAAAATTCCTCCTAATAAAGTTTTCCCTAATAGTGTTTATTGCACAAGCAACTTTTCAAAAATCTATATAAACTAGGGTAAAAGTGCTGAATGCAAAAT
CGTAATATTTTTTTTTTGAGTGCAGATCTGGGAGCGGGCTTACCACATGGACACCAGTGGGTCGACCGGCCTCGGGCCGTGAGTCTTTCATCAGCCGGAGCAAAAGAGCCGGAGCCAAGA
CCGAAACCGAAACCCGGAGTGGAATTTCATGGAGATGGGGTGCTGCTTTGTTTATGTGGCTCCATTTGGGCATATGCATGACCCACTCAACCACCCATCAGTGGCACCCACCACCATCCT
GTGGTTGCTGCTGTTGTTGGGCTGGGGCCTCAAGCTCCACGTGAGAGTGGTTTTAGTGTTGTTCTGGATTCGCGTACCTCCTAGTTGCAAAGCGAAAGGGGATAGTCATTTTATGAATAT
GTAGGGGCACTAATTACCAAACTAAAGGCTAAAAATCTATATTACATTATGGATTAAATCGAAGAGGAATATTGTCTAAAAATGCATTTTAAGATATTATAAATAATAAATTAGTTATTA
CTTAATCTCAGACATTTAGGTACGCACTACATTAAGTCGCAGAGCAGAGACTACAGGGTATCATTGAGTCGCAGACCTCGGCTTAAGCGCTCTATCTTGTTCTGGATTTTTAAGTTGTTT
TCGTTGTCGTAGCTTGTTTGTGTTGCCTTTTTTGTTGTCCTGTGTGCGAGGTTTTGCCTTTTTCCTGTGTGTTGCATCCTCGTCTTTAGTTGCAATTTGAGCACAGACACAGAAGCAGCC
AGGATTGCACTTGGCCAACACACACGCACACAGTCACACTCGCTCACACTCACACTCACAGTCACAGTGAAATGCTGACACCAATTAGGCTGCAGGTTGTTGGTGTTGCTGCTGCCATTA
GTTGCTGTTGGTAGTTAGTTAGTTCGGTTGCACTTTGTGCGTTGCATGTTTACAGTGGCCACAAAACATAATTTCTGTTTAGACAACTTTAGCCCCAGCTCCAATTGCATTGGCTTCTGG
CAAAAAGCTTTGCGAAAAGGGGTGGAAAAATACAAAAGCGGAAAAGAGCGGAAAACAAAACAGGGTCATAATTATTGCGCCAACAAAGACAGCAAAGCAGCTGCAACATCGGCCGGCGGT
AAACGATGTTGCCAGCTGAATTTTTGGTATAATTTTCACTTTGGCCAAGAAACTTTTTCGCTGCCGCATTGAATTTGCAACCAGCGAGCAGCTAAAGCCCGACCAAAAGCAACAGCAACA
AAGTTCATGAGTTGATTAGAAAGTTTTTTAACCGCTGTTGCAGCTACATCCTTAACCCGCTGAAATCCTACAGCCATGCCCCCCAGCACATCCTGCACTCAGATAAACTACTATGGCTTT
CACCAAGTACAAGGCGTTTTCCACTACTAATATATAAATATGTTGTTCAATATTCGGTAACCAAATACTCTTTACTCTCATCGTTGTGCTGGGGAATTTCTTTAAGTGAGCCGTTGCTAA
TGGCAGCTCGTGAGCTTGGCATATGCGAAAAGACCTCAATCAGCGGCTTAGGCTCCCAACGCCGCACTGCATGCTATATGCCACATGCCACATGCCACATGGGTAGTACGAGCTGGTTGC
CGGGGCTGGTGGCTTATCGCTTGGCTGCTTTGTCGCCGGGCAGGGGCATAAACTATGCGAGCATCAACTTTTTGTAATTAATTTTTAATGTGTGCAAAATGTTTGAGTAAACGAGCATGT
TGTTGTTTGCCGAGCCCCGGTATATCAAGCGGATGTCGTTAGAACGGTTTATCAAGCGCTCTAAGAGGCGGATAAACTGCGGCTTCGGTGGGGTTTGGGGGGTGGGGGGTTCTACTATAT
ACTATTTAAGTTTGTGCTTAGCTGGCGTAAATAATTGGATTGCGCTTAAAACGGGCGGTTGCGAGAAGCCAAGACTGCCAGGCTTCTGGTTATTCAAACGGAATTTCTTTGCACTAATTG
CATATGACAATGCTGAAAAACATCCATACATCCCCACCTGACGCCCCAAAAACCCCTCCTAACACCCATCGAACACCCATCTAGTGTGCGAGCGAGAGGAAAGAAGGAGCAACGCAGACC
GCATGACGAGAATTGGCAACTTGCTGCAATTTGCCAGAACCAAAAATTGATTTACCCTCAACTGCAAGTCTTCCCGCCTTCACACAGTTTCCAAGGCACTTGGAAAAATGTTGTGTTGCT
TTTAGCAGCGATGTTTGCTGGCAAGCTGCAAACTCAAACTTTAAAATTTAGCACAATTTGCATCACTGGCCAGCTTGCGTATTTTGCCGAGTTGGCATCATTGACTACCGGGCATATTTG
GCATCATTCCTTGTATCCGTTCAGACTTTTAAGCTATTTGCCATACGCAATATTTAAGGATTACTTTAAGTGTTGAAACGCCACAATGTGATTATTAGAATTTTAGAGTGCCAATAATTG
GCAACTTTGACAGTCGTTTCAATTTGACATCATGCACTGAAATGCCAAACAGTAGAGTGGTTTTTCTCCCAGTGTTCAGCCCGACTCGCATCCATCCATCAGATAAACGTTTTGCTATCT
GCAATCTGCGAATCGCATTTTGTCTCTTTGTCCACGCCATCCGCATCCACTCACGCTGTGTCCGTTGTTCTTGTTGGTTTCCCGGCAACATTTTTGCAGAGATTTGCGTTTCAATCACAT
CGAGGTGCTGCCGGCCAACGCGTTCAGCGGTCTCGTCCAGCTGACTACGCTTTTCCTGAACGAGAACGAGCTGGCTTACCTGCAGGATGGGGCTCTCAATGGACTGCCGGCGCTGAGGTT
CCTCTATCTGAACAATAATCGGCTAAGCCGCTTACCGGCGGACATCTTCCAGCAAATGCCACGCCTGGAGGCGATGTAAGTGAACCCTCCTTAATTAAGGATCCCCTCGAGCAATCGCCT
TACCTAATATCCTTCCTTCTCCTGTCGCCGCCTACTGCAGTTTCCTGGAGAACAATGACATTTGGCAGCTGCCCGCCGGGCTCTTTGACAACTTGCCGCGCCTGAACCGCCTGTAAGTCG
ATGATGGTTCGATTCCCCTTTTTTTTTTCCTTTGAGTGAACCTCTCACTAACTTTCTGCACTGCCCTGCCCTCCGTCCAGGAACATGTACAACAACAAGCTGGCCGAACTGCCAGTAGAC
GGATTTAATCGGCTGAACAACCTGAAGCGCCTGCGACTGGACGGCAACCCCATCGACTGCAATTGTGGCATCTACTCGCTGTGGCGCCGCTGGCACCTGGATCTGAAGCGCCAGCTGGTG
TCCATCTCGCTCACCTGTGCCGCTCCCCAGCAGCTCGAAAAGCAGGGCTTTTCCAGCCTGCGAGAGCAACACTTCAAATGCGGTACATTTACATTTCCATTTCCATTTAAGTAACACATA
GAACATGAAGCAACTTAATGTTTAAGTGCACTTTTCATCAATTTGAAAGAAACACGATTGAAAGCACGATTTCTGATGTGCGGCACAGCTGCATTTTAATACCGAATTGATGGCCACTCT
ACTTGAAATTACTTGCAGCCAAGCCGCAGTTCCTGGTGGCACCACAAGACGCCCAAGCCGTTGCCGGGGAGCAGGTGGAGCTGAGCTGCGATGTCACCGGCCTGCCCCGCCCCCAGGTCA
CGTGGATGCACAACACGCAGGAGGTGGGCCTGGAGGAGTCGACGGGGGCGGAGATCCTGCCCAGCGGCAGTCTGCTCATCCGCAGCGCGGACCCCAGCGACATGGGCATCTACCAGTGCA
TCGCGCGCAACGAGATGGGTGAACTGCATTCCCAGCCCGTTCGCCTGGTAGTTAATGGCGGTAACCACCCACTCGATTCGCCACTCGACGCCCGCAGCAATCAGGTGTGGGCGGATGCCG
GAACATCCACGCACGGAGCAACGACTGTGCCCTCGCCATCGCCATCGCAACCGCACTTTACACACCAGCCGCACGACCAAATTGTGGCCCTTCACGGCTCTGGACACGTGCTGCTCGATT
GCGCCGCCTCCGGCTGGCCACAGCCGGACATACAATGGTTCGTCAATGGCCGCCAACTCCTGCAGTCGACCCCCAGCCTCCAGCTCCAGGCCAATGGCAGCCTCATCCTGCTGCAGCCCA
CCCAGCTATCAGCCGGCACGTATCGCTGCGAGGCTCGCAATTCTTTGGGCAGTGTCCAGGCCACCGCCCGCATCGAAGTGAAGGGTGAGTAAGTGCCAGAGATGCTCCATGCTGAGTGGG
AATTCCCTTCCAATCGAGGTACAGAAGTACCATAAAGGGGTCTAAAGGTATGCCCCTATATATGACTGTGTTCATCTCAAAAGAACAAAATACTGTTGGACACCTTTATAAATTAAAACT
TTGGTATAAAGTATTTACGGAAGTGTGCACCCAAGTACTGAGCATCTCTGGAACAAGCCTGGTGCAGCATCCACATAGGGTCCCTTTTCAGGCCACACTCCATGGCCCTGTGACTGCCAC
ACAGTTGCAGCAGGAATAAGAGTCACAACTGTCGCGTTTTACTCAATTTGCAGTCGATTTAATTTGTTTTCGTCTGGGAAAAGGGCAAATGGGGAGTGGCGTTTGAGACTGACCAGGATG
CTGGCCAGGCCAACTGAACTGATATCATCGGGGCATTGGGACTTTGCAGATGAGTTTGGCCTCCGGGCAAAGGAGCCCACTGTCCGTTAGAAATATTGCGACAACTTTGACAGCAGGTGG
TGCCGGTAATTGGATGCAACTTCATGTAGACAAATCAAATCACAAAAGTTTGTGTTTTTGCAATCGGCAAATTTGGCAATTTGGCAAGCAAAAAAATGGGTGTTCTTTTTTTTCTACAAA
ATATTTTTTCGGTAGAAAAGTTGTCCGTAATATTTTCAATGATTTACAGAAAAAATTTGATTTTTAAAATTGTGCTGAAAATAAATCCCACAACTTATCCAGCTTGGCTTGCTGTGGTTT
TAAGCCCTCTACGGTTTTTTTCCAGTGCAGTGAGGTTATGCGGTGTAAGTAAATGGTTCTGGGTTTGATTGGCGCCCATTAAGCGCTCTCGCTTCGTAGCTTCTTGCCCATTAAATAAGC
GATGAAGTGCATCCCGGCAGGAGGTTAAGCCCGAAAACAACTTGGCACTTGAGCTTTTTATGTTTTTCCATTCGTTATTGCCGTATTTCGAGCGCTTGTACGTGACTGTACTTTATTGCG
CAATAGAAACGGCCAACGGGGAGTGAAATTTATAAATATATCCCCCGGGGAATGGGGATCACAGACGGCGAAAAGTGCATCCATCCACCGCCTTGATGCAGCACAATGGCTCATTATAAT
TTGTGGTTGTCGGCACAAAATGAAGTGCGAAATTTATGCATTATTTTGCTGAATTAAGTGCAAAAATTATAAACTATTATGTGCGGCGAGGGCACGCACAAATTGCGCGCTGTGGCTTTA
AAAATGTGGAGTGGGGCTTAGGGGATCACGGCTACCACGGGGCGGATGAACTGTTTAAGCAGTCAGGCATGGCGCCTGGTCAGCATAATTAACCCGCCAAACGCATAAACAGACACGGGC
AAACACTCGAACAAACACAAACATTCGTACACAAGTAAATATGGCGGCCGCGCTGAAAAGTATGCAGCGAAAAGTTCATATTTCATATTACGCATACGCCCCATGGGCATCGACCAACGC
ACAGTGGTGTTGGGAACGGCAACAAGTGCGGATTGGGTGGATTAGGATATGTTTTGTACGGCGGTTTTAAGCAATGTGGATTATAAATATAGTTTGTTTGGGACATACTACTTATACTTT
AAAAATGTATATACATTTAGCTTGCATATCAGATTTTGCACATGAATTCCCACGGCACGGCGCTTAAAGCGGGTCAAAATGCGAGAGAGGTGGGGGAGGTGGGCATTGGGGGTTGGTGGT
GCTGCGGCAACAAAAGACTCATAGAAACCGAACCAAAAAGCCAGGCCTCGCTTTAGTCGCTTGTTGCTGCCATTTGGAGCAGTAAAATTGCTCGAAAATCACTCATTCGCCCCGTTGCAC
CGCTTGCCACTCTTGCAGAACTGCCCGAAATTTTAACGGCACCGCAAAGCCAAACAATCAAACTTGGCAAGGCCTTTGTGCTGGAGTGTGATGCCGATGGCAACCCGCTGCCCACCATCG
ACTGGCAGTTCAATGGAGTCCCACTGCCCGGAAATACGCCCGACTTGCAGCTGGAGAACGAGAATACCGAGCTGCTGGTGGGCGCTGCCCGGCAGGAGCATGCCGGTAAGTGGGCGAAGT
GATTGCCAAAACGGTTTACATTGCATTTCATTCGATACCTTGGACATAATCCCGTGAATCCTGCCCATTCTGCTCCTCCTCTCCATCCTCTGCAGGTGTCTATCGCTGCACGGCGCGCAA
CGAAAATGGGGAGACGAGCGTGGAGGCCACCATCAAAGTGGAACGGTCGCAGTCGCCACCGCAACTCGCCATCGAGCCGAGCAATTTGATGGCCATTACGGGCACCACCATCGAGCTGCC
CTGCCAGGTCGACCAGCCGGAGGACGGACTGCAGGTAAACTCACTTACCGCGATTGGCCACGGAATCGGAAACTTTTTATTTACCCGCCACTTGTTGACGTTCCCTTTTGGCCTCGTTTT
CCGCTTGGCCACCGCAAAAAATGTACCCAAAAATGGCATTCATTTCGGTTTCATAGTTAGTTTTTGAAGAAAGCACAAATTATATTATAGGTGTCTATAATATAATTCCTATATTATTTG
AAAACCCACGGTGCCTTTCCCCTTGCAAAATGAAAAATGTTTAAATTGAAATTGCAATATAAAATATATATAACCTTTTTTTCCACTGCAACTCCCCAGATTACGTGGCGCCACGATGGC
CGGCTCATTGATCCGAATGTACAGCTGACGGAGAAATATCAAATAAGCGGCGCCGGCAGTCTGTTCGTCAAGAATGTGACCATCCCGGATGGCGGACGGTACGAGTGTCAGCTGAAGAAC
CAATTTGGCCGGGTTTCCGCCTCCGCACTGGTTACCATCAGGTGAGCGAACGCGGGATACCGAATCAAAATCAAATACCTCAACTTTGGGCGCCGGCCGCAACTTTAATTGCGCTGTCGG
CGGCGTGAAGGGCGGATTGCATAAAACTCCATTAAAATCAAAGGGAAAACTTTTGCTCAAAGGCGAAAGAACTGGGGAAGCTGGCAAGAAAAGGCCTCTGCCCACAGAGGATGCACTTAA
AATGCGTTTAAGTGCGCGGTAAAGTTGCTTAATTAATTGAAAAACAGTTGAGCTGCAGAAGAACTGAACATTAAGTTAACGATGCAGCGATGCCGGAAAGAAGTTGGCGTATATCTTGAC
ATTTTTATGCAACGAGCTTGGTAAAGTCACTTTAAAAAGCCTGCAGGTAGCGCACTTCATCAAGAATTTCAAATTGTGTTTAATGAAATCAAAATGCTTTACAATTATTGCCAGCAGACT
TGAACTCCGCGCGCCTGAAATGATTTTCGAGGCCTTGCGGAGTTTAGCTGAACTAAATTGCTTGGAAACCACTGCCGTCAACTATGAAAAGAACATAAAACCATCAAATAAAGCTGCTGG
CTAAACTGCAGCACAGTGGCCAGAAAACGAGTGAAAATTCTGAAAAATCTAGGGGATAAACATCAAACTCCGACTGGCTGTTATCAAAAGCAGTTAGCAGCTGCGCAAACTTGCTAATCC
TCTCCAGTTGCCAAGCCACTGGGATCCACTGTGTTGTTAGCTAAACTGCAAATAAAATATGCACCCAGGCTCCAACTGCAACATGAACATCAAAAGGCGGCGGAGGAAAGTACAAAAGTT
GTCGCCGCCATCGTCAGTTGCTAGTTGCCAGTTTTCAGTTACCAGCTTTCTGTTGCCAGTTGCCAAACTGGAAGACGTGCTAAGCCCGGAAAAGCTACGTGCCACACTCACACTTACATG
CCATCGGATTCGGTCGGGAAAATGGGAAAATGAGAAGACACAGGCAGTGGAAATTCCTCACTGAAGCAACCGCACAAGTTATCCAAATTGCCCAAATTGAAATTGAGTTGACAAGTTGCT
GGCTGCGACAAGAAAAAAAAGGGTTACACACTAAATTAAAAGTGTGTTTTCTTTGATGAGAAATGTAGAGCGGAATAATAAATTTAAGAATTAGTATTCCTATGGCTGTATTACATGAAG
ATATTCCAAAGCTGGATCTAGAATAAATAGGTTTCTTTAGAACAATTTGTATGCTATGAACCTAAATATTTATAAATCGAACTATTTATCTGCTCTTGAAACTCAGCTACTTATTATTGG
AATTGCATATGCATTTTGCTTATTTTCTAAAGGTGCACAAAAACTAGATCTTGTACCTCAACTTTTGCACTCCTTTTGGGGCCTTAGAAGTTTTCAAATTGTTTGTTCCGAGAAAAAAGG
GACACGACGTGAATTTATTGAGCAAATGGTCTCTGCATCCATCCGCCACAAGCCGTAAATCAATTTGAGGCGACAAAAACGGAGCCGTGGATGCGGACTTGGCCATTAACCACCGACTGG
CGAACTGGAGACCAATGATGGGCCACCAAAGAACCGCCGGAGCGGCTTACTTTCTGCTTACACAGCCATTTTCCTGATGCATAATGCAGCAGAAAAGCGGGTGAATGCTGGCGGGAGTCT
GTGGATTTCCATGTGTGGCTCGGAGCACGGAGCACGGAGCATTTAATGCCAGGGACGAGGGCACGGTAGCTGAATCGGCTTACAGTTCTGTGCCGGCAGCATTAGAAACTTTACTCATTA
CGCCGGGTTTTCCCCGTTTTCCCAGTCGCCAGACCGCAGCAAAGCAGCGGGGGCGGAAAATTATAAAGAAAAAATCCAGAAAATGGGTGCGAGAAAGCCGGGCGCCAAAAGTGAAAAACT
ATGTTGGAAGAATGCAGGAGTCGCAGGGATCCAGCAGCAGCTATCCTGCCTCATAAAGAGTGTGGGTGAAAACCGCTGAAAGACCCCGGCGTAACCAGTGCAACAAAAATAGCAAAAATA
ACAAAAACTACCAAAACACCCAGAAATCCGCCTAAGTTGTGGGTAATGCTGGGCGTAAAACAAAAGCTTATCCTGTTACGGCCACTTTTGTTGTTGGCGCTCCTTGCGCAGCCACTGCTC
CTGTGATCCTGCTGCTGGCAAAAAGGCTAACCACGGAAATACATTGCCGTGCGCCACAGCATGTGGCAAGTGAGGAGTGAGTCGAACGGCAGCCGGGACCAACAGAGCAAATTTACACCA
AATGGGGCAGCCGCAAGTGGTGACTGCAGGTATACCCTTACTACATGATTTATAATAAATTACTTTCAAAGATAAACACTATAGTTCACTCTACAAAGATAGCAAGTTGAATTTATAGGC
AAGGCACTGACTTGAAAATATTATTATCTGGCCTTTCTAAATTCCAACAACTTAATTATAATCCTGAAACAATATTAAATGAGTATAATTTACAAATATGAGAAGTGTGCTTTCCAATTT
TAAATCATTGTTAAAATCTGGCTAATAAGTTTCCTGCCAGTCTCCTTGTACGTTTTTTTCTTTCGCGCACTTTGCGGAAACAATGAATTTGTATTAAATTTAATTGAGTAAACTATTACT
TGCGAAGAATAACAAACAAGTAAAATTAATACGTTTTGCCAGAGATAACGTTTATAATTCCCTTGAGGTACCGCTAACCTACGAACTTTTTCACTATGGCTTTCCCACTTTTAAACACAC
TTTGAGGCACCTCGAAAAGATCCATATCTGCTGAAATAATTGTCCGAGTGATGCGGCAACTTTCGCCAAAAACTATCAATGTCCAAAATACCGTGGCCAATTGTCAGCTATAGAACAACG
AACACCCCGTCGAGTCGCCCGGAGAAAAGGACACTGCCAGGGGGCAGCCACAGGATGGCAGCGTGGAAATATGTAGTCCTTGGCGCCGCAATATCCACTGACTGGAGCCGGAGCACCAGG
ACCAGGACCAGCAGCAGTGGCAGTGGCAGCTGGCAACTGGCAACCGATAGTGGCAGAGTCTGGTGCAACAGGGTGTATTATGGTCGTTAAGTTATTACCTACAGCAGCGCCGTCGCCACA
CAATGCCAAAGTTTACACAGTCGAAAGTTTCCTAAAGGAGCATTCCTTGCCAGCAGAATGCCAGGCATGAATTGTTGTTAATGCTGCCCCCCATTCAGCTCCTCCATTCAGATTCAAGGA
AGGCGAAAAGCAAGGCGCGGATTTTTCCTATGACTTTTCCTATGCGCTGCAAAAAGAATGCAGCATAATTTTGTGGGTAAGACAGGCGCAGAAAGGGGAAATGGACTGCCCGGCATTTTT
ATTAGACAGCGCGGCCATTTGGGCGACTCCTGCCACGGGCATTATGGTAATTAAAATGTGCAAATTCCCTGGGATATCTTGATTGTTTCTGCGCTTTGTGTTCTTTATGTGCGTGTCAAC
TTTGCCTCCAGGCATTTAATAAAGATTAATACAAAAACTAAATAGAATGCTATAGTCGAATTCCATGACTATCAAATACCCGTTACTCAGCTACCACCAAAAATTTTAAAAAATTAATTT
CTTAATTTGAATGCAGATTTTTAGAGAATTGCGCCAGAAAAATTTTNNNNNNNNNNNATGGAGATTAAGATCAGCCTTAGGACATTTCTTCATTTTCTTGTATTTCTACGACATCATCAC
ATCAAGAAAATTACAAAAAAATGTAAAATAAATTAATTTTTAAATTTGAATGCAGATTTTTAGAGGATTGCGCCAGAAACATTTTGAGGTTTGCCACTTCAAAATCCGATTAAGATAAGT
TGAGTTATGGACTTTAGAACTTCAGCCTTAGGACATTTCTTCATTTTCTTGTATTTCTACAACATCATCACATCAAGAAAATTACAAAAAAATGTAAAAAAAATTAATTTCTAAATTTGA
ATGCAGATTTTTAGAGGATTGCGCCAGAAACATTTTGAGGTATGCCACTTCAAAATCCGACTAAGATACGTTGAGTAATGGAGTTTAGAACTTCAGCCTTAGGACATTTCTTCATTTTCT
TGTATTTTTACGACATCATCACATCAAGAAAATTACAAAAAAATGTAAAAAAAATTAATTTTTAAATTTGAATGCAGATTTTTAGAGGATTGCGCCAGAAACATTTTGAGGTATGCCACT
TCAATTAAGATAAGTTGAGTTGTGGAGTTTAGAACTTCAGCCTTAGGACATTTCTTCATTTTCTTGTATTTCTACAACATCATCACATCAAGAAAATTACAAAAAAATGTCAAAAAAATT
AATTTCTAAATTTGAATGCAGATTTTTAGAGAATTGTGACAGAAACATTTAGAGGTATGCCACTTCAAAATCCGATTAAGATAAGTTGAGTTATGGACTTTAGAACTTCAGCCTTAGGAC
ATTTCTTCATTTTCTTGTATTTTTACGACATCATCACATCAAGAAAATTACAAAAAAATGTAAAAAAAATTAATTTTTAAATTTGAATGCAGATTTTTAGAGGATTGCGCCAGAAACATT
TTGAGGTATGCCACTTCAAAATCCGATTAAGATACGTTGAGTAATGGAGTTTAGAACTTCAGCCTTAGGACATTTCTTCATTTTCTTGTATTTCTACGACATCATCACATCAAGAAAACT
ACAAAAAAATGTAAAAAAAATTAATTTTTAAATTTGAATGCAGATTTTTAGAGGATTGCGCCAGAAACATTTTGAGGTATGCCACTTCAAAATCCGATTAAGATAAGTTGAGTTATGGAC
TTTAGAACTTCAGCCTTAGGACATTTCTTCATTTTCTTGTATTTCTACGACATCATCACATCAAGAAAATTACAAAAAAATGTAAAAAAAATTAATTTTTAAATTTGAATGCAGATTTTT
AGAGAATTGTGCCAGAAACATTTTGATGTATGCCACTTCAAAATCCGATTAAGATAAGTTGAGTTATGGACTTTAGAACTTCAGCCTTAGGACATTTCTTCATTTTCTTGTATTTCTACG
ACATCATCACATCAAGAAAATTACAAAAAAATGTAAAAAAAAATTAATTTCTAAATTTGAATGCAGACTTTTAGAGAATTGCTCCAGAATCATTTAGAGGTATGCCACTTCAAAATCCGA
TTAAGATAAGTTGAGTTATGGAGTTTAATACCTCAGCTTTAGAACATTTTATAATTTTTTTGGACTCCTACATAATCACATCAAAAAAATTACAAAAACAATAATGAAATGCTATAGTCG
AGTTCCCCGACTATCAGACACCCATTACTCTGCTAGTGAAAGTGCGAAGGAGAAATTTCATAATTTTCTGGAATATCGTTAAAAATTGCGAATAAAATTAAGAAATTAAAAAAAAAATTG
TTCAAAAGTGTGGGCGTGACAGATTTTTCCTTCGGCCTGTTACCTACTTTTCAACGAATCTAGTATACCCTTTTACTCTACGAGTAACGGCTATGCTGTAACGGGGCTTGGGGTCACCAA
ATGCCATGCCTTGGGTCGCCAAACTTTCTTCGATTTATTAAACTTTCGGCTTATTATTATTCGGTTAACTAATCGACCTTTGTTTCGTTCCTCACTTAGAAACAACGTGGATTTGGCTCC
AGGAGATCGGTATGTGCGCATCGCCTTTGCCGAGGCAGCCAAGGAGATTGACCTGGCCATCAACAACACCCTGGACATGCTCTTCTCCAACCGATCCGACAAGGCGCCGCCCAACTATGG
CGAACTACTGCGGGTCTTCCGCTTTCCCACTGGAGAAGCTAGGCAATTGGCCCGCGCGGCGGAGATCTACGAGAGGACACTGGTCAATATTCGGAAACACGTCCAGGAGGGAGATAACCT
GACCATGAAGAGCGAGGAGTACGAGTTCCGCGATCTGCTGTCACGAGAGCATTTGCATCTGGTGGCGGAGCTATCGGGCTGCATGGAACACCGTGAGATGCCCAACTGCACGGATATGTG
CTTCCACTCGAGGTACAGGAGTATCGATGGCACCTGCAACAACCTGCAGTATCCCACCTGGGGCGCTTCACTCACCGCCTTCCGGAGACTGACGCCACCGATTTACGAGAACGGTTTCAG
TATGCCCGTGGGCTGGACCAAGGGCATGTTGTACTCGGGTCATGCCAAGCCCAGTGCGAGACTGGTGTCCACCTCCCTTGTGGCCACCAAGGAGATCACACCGGATGCCCGGATAACACA
CATGGTGATGCAGTGGGGTCAGTTCTTGGATCACGATTTGGATCATGCCATTCCATCCGTGAGTTCGGAGAGCTGGGACGGCATCGATTGCAAGAAGAGCTGCGAGATGGCTCCACCGTG
TTATCCCATTGAAGTGCCCCCGAATGATCCGCGCGTCCGAAACCGTCGTTGCATTGATGTGGTGCGATCCAGCGCCATCTGTGGATCCGGCATGACCTCCCTCTTCTTCGACAGCGTACA
GCATCGTGAGCAGATCAACCAACTGACCTCCTACATCGATGCATCTCAGGTGTATGGCTACAGTACACCATTCGCCCAGGAGCTGCGCAATCTGACATCCCAGGAGGGATTACTGCGCGT
GGGTGTCCACTTTCCGCGCCAGAAGGACATGCTGCCCTTTGCTGCTCCCCAGGATGGCATGGATTGCCGCAGGAATCTCGATGAGAACACCATGAGCTGTTTTGTTTCGGGCGATATCCG
GGTGAACGAGCAGGTCGGTCTGCTGGCCATGCACACCATTTGGATGAGGGAGCACAACAGGATAGCTAGCAAACTGAAGCAAATCAATTCCCATTGGGATGGGGACACCTTGTACCAGGA
GGCTCGTAAGATAGTGGGTGCCCAGATGCAGCACATCACCTTCAAGCAGTGGCTGCCCTTGATTGTTGGCGAAAGTGGCATGGAGATGATGGGCGAGTACCAAGGCTACAATCCCCAACT
GAATCCCAGCATAGCCAACGAATTTGCCACGGCCGCCCTGCGATTTGGCCACACCATCATAAACCCTATTCTCCATCGCTTGAACGAGACCTTCCAGCCGATACCCCAGGGCCATCTGCT
CCTCCACAAGGCCTTCTTTGCTCCCTGGCGTCTGGCCTATGAGGGTGGAGTGGATCCACTGATGCGGGGTTTCCTGGCCGTGCCCGCCAAGCTGAAGACCCCAGATCAGAACCTCAACAC
TGAGCTCACGGAGAAGCTGTTCCAGACTGCCCATGCTGTAGCATTGGATCTGGCGGCCATCAACATTCAGAGGGGCAGGGATCACGGAATGCCCGGCTATAATGTCTACAGGAAGCTATG
CAATCTTACAGTGGCTCAAGACTTTGAGGACCTAGCCGGCGAAATTAGTAATGCCGAGATACGCCAGAAGATGAAAGAACTGTATGGACATCCGGATAACGTGGATGTTTGGTTGGGTGG
CATCCTCGAGGATCAGGTGGAGGGCGGCAAGGTGGGTCCTCTATTCCAGTGCATGCTGGTTGAGCAGTTCCGTAGGCTTCGGGATGGTGATCGGCTGTACTACGAGAATCCCGGTGTGTT
TTCACCCGAGCAACTGACCCAAATCAAGCAGGCCAACTTTGGTCGCGTGCTCTGCGATGTGGGTGACAACTTCGACCAGGTCACCGAGAACGTGTTTATTTTGGCCAAGCACCAGGGTGG
CTACAAGAAGTGCGAGGATATAGCCGGCATAAATCTCTATCTGTGGCAGGAGTGCGGCAGGTGCAACAGTCCACCGGCCATCTTCGATTCCTACATACCGCAAACGTACACCAAGCGGAG
CAACAGGCAGAAGAGAGATCTCGGCAAGGAGAACGAGGAGGTGGCCACCGCCGAGAGCTATGACAGTCCGCTGGAAACCCTCTACGATGTGAACGAAGAAAGAGTCAGTGGGCTGGAGGA
ACTGATTGGCAGCTTCCAGAAGGAACTGAAAAAGCTGCACAAGAAGCTGCGCAAGCTGGAGGACTCCTGCAATTCCGCCGACTCCGAGCCAGTGGCTCAGGTGGTGCAGCTGGCGGCGGC
ACCGCCCCAGTTGGTTTCCAAGCCCAAGAGGAGCCACTGCGTCGACGACAAGGGCACCACCCGGCTGAACAACGAGGTCTGGTCTCCGGATGTCTGCACCAAGTGCAACTGTTTCCACGG
CCAAGTCAACTGCCTGCGGGAGCGATGCGGCGAGGTCAGCTGTCCGCCGGGAGTTGATCCACTGACGCCTCCGGAGGCCTGCTGCCCACACTGCCCGATGGTCAAGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGAGTTCCGCTGCTGCTGCTGCAGCTGCTGGGGCTGCTCCTCCTCTCCGGCGGAGTCCAGTCCACCTACTGCCCAGCCGGATGCACCTGCTTGCAGCGAACTGTGCGCTGCATCCGC
GCCAAGCTGACCGCCGTGCCCAAGCTGCCCCAGGATGCCCAAACGGTGTAAGTACTCAATGGACCTAAGATCCTCGCTATTTATTTCAATTCACTCGTATATATGTCGGGCTTAAAAACT
CAACAATGTATATGGATTCGTTCAATAATTAAATAACTAAAAAAATCAAGCAATTGGAAGAACTTTTATGGCGCACCTTGATTTTCCTAAGTTCCTTAAGTTCAAAATGCACTTTTTATG
CTTTTAATATTCTTGTCCAAGTTTGGCTTCCAGTTTCCTTTCGTCGAGTGTACATAAATCAACGCGGGAGTTGGCTTGCAAATCCATAAATTAGTTTTTAATGTTTTCTGTGCACGCTGC
GAAAAGTTGACGGCGTTAATTTGACGCCCCTTTTTCTGCTCCTCCTTCCGTGGAGGAGTCCTCCTCCTACGACTGCTGCTCCTCCTCCTCCTCCCAGGGAGCCCCCTGCTCCTGCGGAAT
CCATGAATGTTCCGCCAAGCTGCGCTATGTTGACTCAATTAAACGGATGTCTAACCGGCAAAAGCTGACTGCGATTTGTATATTTATCACGCTGCCTGTCGCGTATTTGCATGCATGTGC
AATATTTCTGACGTTGCATTTATTTTCGAAAATGTCAGCAGTTTTCGCATGAATTTTGGGCACCACAACCATTCCGCATCCAACGCATACAACTTGGCAAATGTTTGCGAAGCATATGCA
TATTTATGTAGGCCGTGGCGTGTTTCAAGCCGGAGGAACAACCTCGCAACCCGGCAGAATGCACCAGCTGCTGCAGCCGATGGCAAGTTATCATCAGACAGAAAAACAGTCTCCACTGGG
GGACAACAAGATATCCGGACAGACGGAGCACGGTTTTCGTGGTATTTACGGAGAATTCAATTTCCAGCGGGGTTGAGCCGCGTTTGATGGCAGGGATTCGCTGATTCTCCGCCAAGGATT
TCCACAACACGCCAGTCAGGTGCAAATGCCATCCTGGTCCTGGGAATAGGTGAAGCCACTCAGTTCACGTGTCAACGAATGCGAAAGCCCTGAACAAATCGATTATATGGTGCTTTAAAA
ACTATAAAGTGCTCTCGACTGGGGAGCATTATTCGCTGATTCGCTATTCGCCGTTTCTGAAGCACTTTCATGTTTAATCTGATACATTTTAAGTTTGGAAAGAGCGATCATAGAGAATTA
TTTGATAATTCAACGTTCCTGAGGTGGAAAAAGGAGATTTAAATTGCTTGATTAAATTATGCGGCCCGAAAGAAAATGTTTCATTTTTAAAACTCCTGACAGGTGGATAAATTCCACCTG
TCCGTTGAATGGGTGAAACCAATTACTGCAGCTGTCATCGAATTTGGGGTCCCCAAATATGAGGATTTATTATTTCATTTATCGTAGTGGACTGGGGCTTAGCTGGTCGCCATTGAAAGA
GATTGTTCATTTGGCATTTTAAAGACTGCATCTGCATTTAAATAAATATTTCATTTCGTTAAGTAGCGTCGAACAAAACGAAATAAATAGGTGGTATTAGATTATGAATTTAAGCCCGCT
CGACAGGTGACAAAAGCATGAATGGTTGGCAAAAACAAAATTCTAAAACTGAAAAATAACATGAAGCCAAAAACTTTTCTGACCACAGCAGAATTAATAATTGAGTTAACCAACATATCA
GGCCAAAGCAAAACTATGTGCAACCAACAACAATGCCTTTCATATTTAAATATTCTATTGTACAATCCACTCCGCCATCGAATCCACAGCCATTTGGCAATCTCACCAGGAGGATCACAT
TCTTTGCCATTTGCCATTTGTTTGGCTCGCCGCACAACAATTTCTCAAATGGGAGAAAGCTGTGGAAAACTGTTAGTGGGAGCCAACAGCATTTGGCAGTACTTAAATTAATCTTCATTT
TAAATAAGGTGATGGCTGCATAATTTATCATGCCTCGAGAGCAACAGCAGCCGCACACAACAATAGAAAAAAATCTGGAAAACACTGAAAAACACAGAAAAAGACCAAAAAGAGAGCAAC
TTTTAGGTTGCCATTGCGATTCGCTTTTCATTTATTACCCAGCCGACCCGTTGCACACTTTTAATTAATTTGTTTCATTTATTACAGCATGTGTCTAAAAGTTGCTCTTGTTTTCCCCCA
TAGTCATGCACTTGTGCACTTGTGCATTTCGCTTTTGTCTGAGGCTGTCGACTCAGATTCCAGCTTTCTTTCCATAATTCTCGAAATGTTTCTCGGCAGTCTATGAAAAATATGAGCACA
CATTTTCCCAGCCAGAGACACTATCATTTTATAGCTCACACATGCCCACATTTCGTTTCACTCTCCGTGAAAATATTCTTGATTTAATTTCCTTAATGGCGAAAATTCTGTTTACAATTT
CTGTCGGAAGGTCACTGAAGATAAATGTCGAGCAAACATAAAAGAAACGACGTCAAATTGGTAAAAACAGAACAATTTTAGCAGCGTTAAAAGCAAAGGCAATTTCTAGTTAAATTATAC
AAAGAATTTA
GAAGGTGTTCGCCTGGCCAAACTGGAAGCAGCTTAAGCATGCCACAACGAGCAGCCGGGATGATGAGGGTGGTTCCCTCATTGCGTTGGCAAGGAGTTCGCAGGACGACA
ACGAGGACGAGGACGAGGACGAGGAGCACGAGGACTCCCTTAGACAGCCGGCAATCGCATGTGTGTAGAGTG
AGTTGCAGAGGTATGCAACCTTTTTAATTATTTCCCTATTTATACTGC
TGCACCACAACCACACCCACTGATTCATTTTGATTAGTGGCACTGATAAAATACGCCAATCTTGGTGATGGGTTTTCGGTTGGTCTGGAAAAACTTGAGATCGGGTCGGTCAAAAAAGAG
CGGAGTGAGAC
TTTCCTCCGCTGTCAGGAGTTTTTCTTTCGGTGGCAGCCCAAAAGTATGCAATGCAAGTTTAGATGCCTCTTGTTCTTTCAGCGTCCTTTTTGCTCGAGAGCGTGAGTG
CCACTGTGAGTGTGTGTGTGTATGTGTGTTCGAGTGTGTGAGTGTGTGTGTGACGGAAGTGAATTTTCTGCACGTGGCTTAACTTTTGCTGCCTGCTC
ACACACACACAGTAAGTCAGTC
AGAGCAATTGTCATGCGTCCTTTGGACTATCGTCACTGGCAAATCACCTGGGCAACCCGACGGCACACAGGATACTTGGCTGCGAGAATGTGAGTCCTGGCATGCAAGGATGCGCCCGCC
TCGCCGGTGCAGGCACTTTTATTCCTTTGGTTGTTATTGCTGGCCATGTTGCTGCTGCTATTTGTGCTGCTGCCGGCGTGTTTGTAAGCCATGTTATTACAATAATGTGCAATCTGAGTC
TGAGATGGCGCACTGAAAGAAATGTCTATGAGCAAGATGAATGGTCTCAAGTGGGTGCCTTTAATCGGTGCGCCTAAGATTCTGCAGGCATCCAAGCCAATTGAAAAGTATCTTAAGTTT
GAAATCTGGAAACAGCTCCTTAGCAGCTTCCAACCACCAGAAGTATAACGAAACTAGGTGCGCCAGGATGCGATGAGGATGCATCCTTAAACATATAGCATTTTCTCTCTCTGCTGGCGA
ATGCGGTCCCTGTGGTGGCTCGGTGCGGATGAGAGTGTGAGTGTGAGTGTGCGGCAGGCCAAAGTTAAATCATGTTTTTATTGTCACATTTGCCATAAAGGCAGCCGAGGGACCGGCAGA
CCGTAAAAGGATTTGTACTGGCTCAGGAGCAGGAGCGGGAGCAG
GTGCTGATGCCACTGATAAGGCAGCGCATAGGTGGCCCTTTTCTTTCTTTCACCCACGGTTATGGCCTTGTTTACG
TTGCATACTTTATGGCGCAAAGCCGTGTTGGCGGGGGGGCGGAGGGGCGGGGGGAAAGGCGTGTGTGCAAAGCGCGGAAAAAGCGAAGCGTTAGAGTTAACTCTAATGAAAATGCAGTGA
ACTGGAAAATATACTGACTGCATGATAAAAACTAACTGACGCTGAA
AATCAAAGCGACTTGTATAAAAGAGTTCGGATCGTACAATTAGTGAGGCTATAATATTCACTAATAGATAACCT
TAGTGAAATTGCGAAATTCCAGTTGACTGAAATTCATCTGTAATAAGCCTCAACAACCGCAGTCGTGGCAAAATAATCAAACTGAAATCTCAAAAGGGGACACCACAAACATACACTTGC
CGAAATTGCATGGCCCCCTTGGAGTTTCGCTTGTACCCCCAGGAAATCCGCAACTAATTTACTTGCTGCGGTTTTTCCTTCACTAATTGTGACA
GGCTGAACAACGAGGTCTGGTCTCCG
GATGTCTGCACCAAGTGCAACTGTTTCCACGGCCAAGTCAACTGCCTGCGGGAGCGATGCGGCGAGGTCAGCTGTCCGCCGGGAGTTGATCCACTGACGCCTCCGGAGGCCTGCTGCCCA
CACTGCCCGATGGTCAAGTGA

Retrieve as FASTA