Entry information : OtriAPx01
Entry ID 7680
Creation 2010-11-02 (Marcel Zamocky)
Last sequence changes 2016-02-18 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-18 (Achraf Jemmat)
Peroxidase information: OtriAPx01
Name OtriAPx01
Class Ascorbate peroxidase    [Orthogroup: APx011]
Taxonomy Alveolata; Ciliophora (ciliates); Ciliophora (ciliates); Ciliophora (ciliates)
Organism Oxytricha trifallax    [TaxId: 1172189 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OtriAPx01
start..stop
S start..stop
SlemAPx01 459 9e-166 1..273 1..275
ShisAPx01 432 4e-156 66..273 1..208
EvanAPx01 236 3e-78 1..247 1..241
SmAPx05-2_59 209 2e-67 7..243 19..249
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1009..1133 125 N° 2 246..942 697  
complement(join(246..942,1009..1133))


exon

Literature and cross-references OtriAPx01
Literature Swart,E.C., et al. The Oxytricha trifallax Macronuclear Genome: A Complex Eukaryotic Genome with 16,000 Tiny Chromosomes. PLoS Biol. 11 (1), E1001473 (2013)
DNA ref. GenBank:   AMCR01002313.1 (1133..246)
Protein sequence: OtriAPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   273
PWM (Da):   %s   30919.99  
PI (pH):   %s   6.18
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNINHIAKKPFFDLFYRSPCMALMLRAAFHDAGTFCRDSKSGGPRGLLRFQSDLSRPENKGLQFAMDQIEDIKTDGNHITNMLSYSDLIQLGAYAAVEYTGGPTMVFRMGRKDAEESDATPEDRLPDNKEGSSGMVNKMRRTGFSTQDIVAIMGSHTLGFAHQDRTGFQGRWTQNPHVFDNTYYKEVLLGQKSKFLKTPAEHMLLENQEMKRFVEMYAQDQNLFFTHYADAHVKMSEFGQEEHLLSEFDNQPANKLPQVEGIQIGSFSDPQKY

Retrieve as FASTA  
Remarks Complete from genomic (1 intron). Strain="SB310". With the ciliate code, stop codons are translated as "Q".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATATTAATCATATTGCTAAAAAACCTTTCTTCGATCTCTTCTACAGATCTCCATGCATGGCACTTATGTTAAGAGCTGCCTTCCACGATGCTGGTACTTTTTGCAGAGACTCTAAA
TCTGG
GTAAGTAGCGTTTCATATATAAGAGTGTTAATAGCGTAGTTAATGAGTATTGAAAATTGATTTTAGTGGCCCAAGAGGATTATTGAGATTCTAAAGTGACCTATCAAGACCAGAG
AATAAGGGTCTGCAATTCGCCATGGATCAAATTGAGGACATCAAGACTGATGGAAATCACATCACAAACATGCTCTCATATTCAGATTTGATCTAACTAGGAGCTTACGCTGCTGTTGAA
TACACTGGAGGCCCAACTATGGTCTTCAGAATGGGAAGAAAAGATGCTGAAGAAAGCGATGCAACCCCAGAAGACAGATTGCCAGACAATAAAGAGGGCTCTAGCGGCATGGTCAATAAG
ATGAGAAGAACGGGTTTCTCAACTTAAGATATCGTAGCTATTATGGGTTCACATACTCTCGGATTCGCTCACCAAGACAGAACTGGATTTTAGGGAAGATGGACTTAAAACCCTCATGTA
TTCGACAACACTTATTACAAGGAAGTTCTCTTAGGTTAAAAATCTAAATTCTTGAAGACCCCTGCAGAACACATGCTCCTTGAAAACCAAGAAATGAAGAGATTCGTTGAAATGTACGCT
CAAGATTAAAACTTATTCTTCACTCATTACGCAGATGCTCATGTTAAAATGAGTGAATTCGGTCAAGAAGAACATTTATTGAGTGAATTCGACAATCAACCAGCAAATAAACTTCCTCAA
GTTGAAGGCATTCAAATTGGATCTTTCTCTGATCCACAAAAATATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAATATTAATCATATTGCTAAAAAACCTTTCTTCGATCTCTTCTACAGATCTCCATGCATGGCACTTATGTTAAGAGCTGCCTTCCACGATGCTGGTACTTTTTGCAGAGACTCTAAA
TCTGG
TGGCCCAAGAGGATTATTGAGATTCTAAAGTGACCTATCAAGACCAGAGAATAAGGGTCTGCAATTCGCCATGGATCAAATTGAGGACATCAAGACTGATGGAAATCACATCACA
AACATGCTCTCATATTCAGATTTGATCTAACTAGGAGCTTACGCTGCTGTTGAATACACTGGAGGCCCAACTATGGTCTTCAGAATGGGAAGAAAAGATGCTGAAGAAAGCGATGCAACC
CCAGAAGACAGATTGCCAGACAATAAAGAGGGCTCTAGCGGCATGGTCAATAAGATGAGAAGAACGGGTTTCTCAACTTAAGATATCGTAGCTATTATGGGTTCACATACTCTCGGATTC
GCTCACCAAGACAGAACTGGATTTTAGGGAAGATGGACTTAAAACCCTCATGTATTCGACAACACTTATTACAAGGAAGTTCTCTTAGGTTAAAAATCTAAATTCTTGAAGACCCCTGCA
GAACACATGCTCCTTGAAAACCAAGAAATGAAGAGATTCGTTGAAATGTACGCTCAAGATTAAAACTTATTCTTCACTCATTACGCAGATGCTCATGTTAAAATGAGTGAATTCGGTCAA
GAAGAACATTTATTGAGTGAATTCGACAATCAACCAGCAAATAAACTTCCTCAAGTTGAAGGCATTCAAATTGGATCTTTCTCTGATCCACAAAAATATTGA

Retrieve as FASTA