Entry information : GgoEPO
Entry ID 7684
Creation 2010-11-03 (Myriam Duval)
Last sequence changes 2010-11-03 (Myriam Duval)
Sequence status complete
Reviewer Marcel Zamocky
Last annotation changes 2010-11-11 (Marcel Zamocky)
Peroxidase information: GgoEPO
Name GgoEPO
Class Eosinophil peroxidase    [Orthogroup: EPO001]
Taxonomy Eukaryota Metazoa Chordata Mammalia Hominidae Gorilla
Organism Gorilla gorilla    [TaxId: 9593 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GgoEPO
start..stop
S start..stop
PtroEPO 1457 0 1..715 1..715
HsEPO 1456 0 1..715 1..715
MmulEPO 1417 0 1..714 1..714
CjaEPO 1385 0 1..715 1..715
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..76 76 N° 2 192..285 94 N° 3 525..700 176 N° 4 868..985 118
N° 5 1117..1246 130 N° 6 2118..2324 207 N° 7 4105..4423 319 N° 8 6199..6359 161
N° 9 6699..6954 256 N° 10 7385..7555 171 N° 11 10211..10448 238 N° 12 11025..11226 202
join(1..76,192..285,525..700,868..985,1117..1246,2118..2324,4105..4423,6199..635 9,6699..6954,7385..7555,10211..10448,11025..11226)


exon

Literature and cross-references GgoEPO
DNA ref. GenBank:   CABD02154584.1 (1..2514) [5' end]   CABD02154586.1 (1..6176) [3' end]   CABD02154585.1 (1..2489) [Fragment]
Protein sequence: GgoEPO
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   715 (698)
PWM (Da):   %s   80834.07 (79150.1)  
PI (pH):   %s   10.81 (10.81) Peptide Signal:   %s   cut: 23 range:18-715
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHLLPALAGVLATLVLAQPCEGTDPASPGAVETSVLRDCIAEAKLLVDAAYNWTQKSIKQRLRSGSASPMDLLSYFKQPVAATRTVVRAADYMHVALGLLEEKLQPQRSGPFNVDVLTEPQLRLLSQASGCALRDQAERCSDKYRTITGRCNNKRRPLLGASNQALARWLPAEYEDGLSLPFGWTPSRRRNGFLLPVRAVSNQIVRFPNERLTSDRGRALMFMQWGQFIDHDLDFSPESPARVAFTAGVDCERTCAQLPPCFPIKMTPASRTSVTASLSSARHPHAPKTRTESATRSTRSPPLWTPAWCMAVRSPSRCGSATGPTTWGCWPSTSAFKTTAGPCCPSTTCTMTPVSSPTARHASPASWQVRQVQ*I*AWGFQGDTRSTETPKLAAMHTLFMREHNRLATELRRLNPRWNGDKLYNGECSSCLPFQIITYRDFLPLVLGKARGRRTLGPYRGYCSNVDPRVANVFTLAFRFGHTMLQPFMFRLDSQYRASAPNSHVPLSSAYLCCSHSLPPGGIDPILRGLMATPAKLNRQDAMLVDELRDRLFRQVRRIGLDLAALNTEANGRSARLKLLLPIPLQGTMLGGASVGSPSPGIWHSLAGC*KTRTWQGSS*ICMEHLTTLTSGLGPSLSLFCQGLEWGHYKVIPPQPSPTSLDCLVGSGGRNEVFSPKDSARP*AEFPCLELYVTIPVSPRFQGTSSEPTSTLG

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 17, 11 introns), no Gorilla-EST found.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATCTGCTCCCAGCCCTGGCAGGGGTCCTGGCCACACTCGTCCTTGCCCAGCCCTGTGAGGGCACTGACCCAGGTAATAGCCCCCTAGACAGGCAAGGAGGAGGGAGGGGAAATGGA
AGGGGAAGCACTTGGGTCTTGGAGGGGGCCTTGTGGCTTGCTGAACCCTGAGTCCTCATCTCTTTGAACAGCCTCCCCTGGGGCAGTGGAGACCTCGGTCCTGCGAGACTGCATAGCAGA
GGCCAAGTTGCTGGTGGATGCTGCCTACAATTGGACCCAGAAGAG
GTGGACTTGGGTCTGGGGGCTGCATGGGCCTGGGAGGATCAGTGAGGGGCATGGGCCCCAGCCAAATTCACCTCA
CTCATCACCCACCTCTGGACCCCATGAACATTTCCTGTTGGTAGAGCCTCCCTTCCATCCATCCTTCTGTCCGCTTGCCCTGTCCTGACTGTGCCCCAGGACTGGGTCTCTGCTGGGTGG
GTCTGCACCCTCTCTCCAGCCCTCACTCCTCCTCTCCCGGGCAGCATCAAGCAGCGGCTTCGCAGCGGTTCAGCCAGCCCCATGGACCTCCTGTCCTACTTCAAACAACCGGTAGCAGCC
ACCAGGACAGTTGTTCGGGCCGCAGATTATATGCATGTGGCCTTGGGGCTGCTTGAAGAGAAGTTACAACCCCAGCGGTCCGGACCCTTCAATGTCACTG
GTACTCTGATCCCCACTGAG
CCCGCTGGGCCTGCCCTGGCCTGGAGTAGAAGGAATCCAGGAGAGGGAGGCAGGGTGCACAGGCTTGGGGTGCTGGGAGGAGAGAGGGTAAAGGGATGGGAGGTACAGAGCAGGCCAGCT
CAGGTCTGCCCGCTTGCCTTCCCACAGATGTGCTAACAGAACCACAGCTGCGGCTGCTGTCCCAGGCCAGTGGCTGTGCTCTCCGGGACCAGGCCGAGCGCTGCAGCGACAAGTACCGCA
CCATCACCGGACGATGCAACAACAA
GTGCGTGCGGGGCGGCAGGAGGGGCTGCCCCTGCCTGGGGGACCTCTCCCTTCCTGCACCCACCCTCTCCCTCCATGCTGAGCCATCTCCAGGCC
CTGCCCCCTGCTAACCTATCCCACCCACGGCTGCAGGAGGAGACCCTTGCTAGGGGCCTCCAACCAGGCTCTGGCTCGCTGGCTGCCCGCCGAGTATGAGGATGGGCTGTCGCTCCCCTT
CGGCTGGACCCCCAGCAGGAGGCGCAATGGCTTCCTTCTCCCTCTC
GTGAGTTGGGGCTGAGGGCTTGGGAGGTTGCTTGATCTCTTAAATGCGGGGAGTAAAACACAGCCCAGAGTCAC
CCAGGCAGGACTTGAACCCAGGCCCTTCCACTGACCAGTGCAGTGACTCGTGGCAAATAACACAGCTTTCTGAGGCTTAGTTTCCTCATCTGTAAAATGGCCCTAAAACCTACCTCGTAG
AGCCTGTGTGGATATTGAAGTCCTTGGTATAAATAGCTATATAGGACATGATCTATTCACGCTAACCATTACGGTGTTGTAGGGTTTTTTCTGAGAAAATTAGTGTCAAAGTCTTGCTAA
ATATAAACAGCTATATACCTTAATCTGGCTTTATCTATTGATCTATTTCACATTTATCAACTCATCAGTTTTCTATTGATATATCGATATAGCAGTCTATCATCTACCCATCTATCAACA
TCTATTAATTAATTTTCTTCTATCCACCCTTCCATCTGCTGACCCCATACTCCCTACGTGTATTATCCATCACCTGGCAACCAGCCCATGCACCTGTGAATCCATGCTATCATCTGGTTA
GCTATCAGTCTACAAATTGATCTATCTATTTGATCTCCCTTCCCCTCTGGGAGAGCTGGTGAGGTCTGAGCCAGTCAACCTAGCCCCTCTCCTTCTCTTTACCACCGGAATCCTCAGGAG
CCCAGCCAGAAACCATCCTTCTAGGAATGAGAGCAGGAGGTGGCTACGCCTCCAGGGACAAAAGGGGCATGGAGGGCAGAAGAGGAGAGGCTGTCAATTCCAGCAGGGGAGCTGCTGCTC
CCTGAGTCCTGGGTTGGCTCTAATACCTTGTGGGGTCAGGGAGCCCATGTCCCGTGCTGATGTTATTTCCCCACCAGGTCCGGGCTGTCTCCAACCAGATTGTGCGCTTCCCCAATGAGA
GACTGACCTCCGACCGTGGCCGGGCCCTCATGTTCATGCAGTGGGGCCAGTTCATTGACCATGACCTGGACTTCTCCCCGGAGTCCCCGGCCAGAGTGGCCTTCACTGCAGGCGTTGACT
GTGAGAGGACCTGCGCCCAGCTGCCCCCCTGCTTTCCCATCAAG
GTACCTACCCTCAGCCAATCTCCCATGCCCTTGTGTGGCCTCCCCCAAAGGCAAGATGCTGGGAGTGGGGATCTGG
AAGACTGGAGCACCATCCTTAAGGAGCTGCCTGTGGAGCTAGGGTATGAGACAGAGACACAAGAAACACAGCTGAGCAGAGACCCCGCGCTGTGTGTGTTTGAGAGGTGGGGGTNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGGGAAGCCCTTGAGACAGGCCTTGACCCATGGGTCTGAATCCAACAGGGGAAGCCTCTGGGCCCCTGCTTTTGGC
AATCTAAGGGCCTCTTAGCTCTTGCCCTTCTCTCCTTCCCAGAGTAGTCCAAGGGTCCTGCGGCTCTTGCCAGCTTCTTGGGCTTGGGCTGTAAGTAGGGTCCTAACCTTCAGGCTAGAA
GCCAATGACAGTGTGGGGCACTAGGGAAGAAAAGATAGAATCCAGGGAGCAGAGTCTCTGCTAGGAACATAGGGTTGACACACGTGCACACACACACTCTCTCACACACACACACGTGAA
CACACACACTCTCTCCCTCTCACACACACACGTACACACACAGTCACCCTTAATAGGTGGGGCCACATTCATGAGGGATGACATGTGAGGGCCTCTGGATGGCCTCTCCCCGTTGCAACC
TTATCTATTCCTCAATCCCTGGCTTAGGGGCACCTCCTCTGGGGAGCCTTCTCAGATCTTCCTATTGCACTTTTAACATATGTCCTCCCCTCCCCTCTCCTCTCTCTCCTTCCTTCCTTC
CTTCCTTCCTCTTTCTTTCTTTCTTCTTTCTTTCCTTTCCTTCCTTCCTTCCCTTCCTTCCTTCATTTCCTTCCTTTCTTTCTTTCTTTCTTTTTCTTTCTTCTGTCCTTTCTTTATCTT
TCCTTCTTTCTTTCTTCTTTATTATTATTATTATTATTGTTTTGAGACAGAATCTCACTCTGTTGTCCAGACTGGAGTACAGAGGGGCAATCTCAGCTCACTGCAACCTCTGCCTCCTGG
GTTCAAGCAATTCTCATGCCTCAGCCTCCCGAGTAGGTGGGATTACAGGCATGTGCCACCATGCCTGGCTAATTTTTGTATTTTTAGTAGAGATTGGGTTTCACCATGTTGACAAGGCTG
ATCTCAAACTTCTGGCCTCATGTAATCCACCTGCCTCGGCCTCCCAAAGTGCTAGGATTATAGGCGTGAGCCACCACACCTGGCCCACATATGGCTTTTCTATCAAGCACAGAAGATGCC
ACTTCAACTTAGTTTCTTAACTCTATGTGTGTGTCTTTTTCCACTGAACTGCCAGCTTCCTGAAACCTTTCTTGTGTTTTTTTAACCTTCATAGTCTCCAAAGCAGCAAGCAAGAAAGGG
GCTTAGAAAAGGTCTGTCGAATTGAACAGAATTAAAGAAGCTCAGGCCTAAGAGTCAAGAGAACTAAGTTCTAATCCCACCTTTCCTGCTAACTGGTTGTCACTTCCCCTCTCTGAGGCT
GTTTTCCTTGCTGTAAAATGAGGATCGAGATTGTTTCAAAAGCCTCATTCATTCCTAACCTTTTGAGACTCTATGAAACAAAATGTTAAGGACACTCAGACTGAAGGGGTGAGCAGCATG
AGCCTGGGTGAGTCAAGGAGGGCTTCCTGGAGGAAGGGAGTTTTAAGCAAGGTTTTGAGGAGGTGGAAGATGATGGAGAGGAGTGAGTCTGCTATTGAGGGGGCCCCATGTCACTGGCTC
CTCTTCCATCTCAGATCCCACCCAATGACCCCCGCATCAAGAACCAGCGTGACTGCATCCCTTTCTTCCGCTCGGCACCCTCATGCCCCCAAAACAAGAACAGAGTCCGCAACCAGATCA
ACGCGCTCACCTCCTTTGTGGACGCCAGCATGGTGTATGGCAGTGAGGTCTCCCTCTCGCTGCGGCTCCGCAACCGGACCAACTACCTGGGGCTGCTGGCCATCAACCAGCGCTTTCAAG
ACAACGGCCGGGCCCTGCTGCCCTTCGACAACCTGCACGATGACCCCTGTCTCCTCACCAACCGCTCGGCACGCATCCCCTGCTTCCTGGCAGGTCAGACAGG
GAGGAAGGTGGTGTCTT
CCCAGGAAACAGCCATCCCTGGGGTCCCAACTGGGAAGCCATGGTGGGATGTGGTGAAGGTACATGGTTTGGGACCTCAGTATTAGGCACACCATAAGCATGGATCTGTGCACAGCCATC
ATAGAATCAGAACGTTGGAGTCCCTTTGCAAGCTCCCTGTGTGTGGCCAGAGATGACTGCTTAACCATCTCCAGTGACAAGGCTCTCACCGCCTCTATGGCACCCCAGCTCAGCCACAGG
CAGCTCCGACTGTTAGAAAGTCTCCTTATTTTGATCACATATTCACCTATTCCCCTTAATCATGCTTCTGGAACGTCAGAAAAGACACTGTCTCTCTTTCACGCAGGAATACCTCAAAGT
AGCTGTTAACTCCATCTCCATTTCTTTTCTCTTCTCTGGGATAAATTTCTGTAGTTCCTCCCTGTCTGCAGCTGTTGCTAGACAGTTAATACCTTCTTCTGGAAGCATAATTTGAACTTT
CCTCAGGGTCTTTTTTCCCATGTACATGGTTACAATAATAATGGTAGTCATTTCTCATTAAGATATTTATCTTATTATTATTATTATTTTAAGATGGAGTCTCACTCTGTCGCCCACGCT
GGAGTGCGGTGGCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCACCTCTGCCTCCTGGGTTCAAGTGATTCCCCTGCCTCAGCCTCCCGAGTAGCTGGA
ATTACAGGTGCCTGCCACCACGTTTGGCTAATTTTTGTATATTTAGTGGAGATAGAGTTTCACCATGTTGGCCAGGCTGGTCTCAAACTCCTGACCTCAGGTGATTCACCTGCCTTGGCC
TCCCAAAGTGTTGGGATTACAGGTGTGAGCCACCACGCCCAACCTTATCAAGATATTTAAATGTGCCATCTCTAAACCTTGCAACAGCCCTGAAAGGAGGGAATTATTATTGTTCTCATT
TTACGATAAGAAACTGAGACTCAGGGAAAGTGAATCATGCGCCCAAGAGCACAGAGTTAGTTTCAAATGGCAGAGTCCACTTGAGAACACAGTCAGTGTAGTATCAAGGTCTCTGCCCAG
TCCACTGTATTCCACTGTTTTCCTCACAGAGAGTCGGCCCCAACCCCTCTTTTGAAGGATTGTACATTTGTGTGTCCTGGAAAGAGCAGCATGTGCCTTCGGGAGAGGTCAACTGAACTA
AGACCTTGTGCAAAAGGGTTTAGTTAAAACCAAGCAAATGATGGAATTAACTTTCTTTCCCTGCCTGTAGTAGGTCTGTTCGTAAGAACAGTCTCTGCCCAACCCTCCCTCTCTTCCTCT
TTCCCTCTGGTTCACGGGGGAGAGCAGTATTATACCAAGCCCAAAGATAGGAAGAGGTACACCAGCCCTTGGCAGAGAACACCCAGGCAGATGCAGCTCATGGACAGGTGGGCTCTCAGT
CCCAAAGTCAAGGTGCCCTTGCCCATAGCTGGTCCAGGCTATGGATCTGGTTGTCTTGTAGAGTAGAATCCTTAGGCAAAGATGCCCCTGCCTGAGACCAGCAGCTGCCCTGTGCTTTCC
CACCTCACCCAAGCCTGCTAGGAACCCCCGGTCCTCCCGCTCCTGGCCTGTGGTGTTAGGGAGGAGGGTGGCGATGAGGAGCCTCAGCACAGCTGTAGAGATGGAGGTCCAGTGAGGGCC
AGGAGTTTGGCCCACCCCGTCTCTCCCGTCCCCAGCCCTGGGTCTACCCTGGTAGAAAGACATTTCTCTGAGAAAGGCTGCAGTAAATCTGAGCTTGGGGTTTTCAAGGTGACACCCGAT
CAACGGAAACCCCCAAACTGGCAGCCATGCACACCCTCTTTATGCGAGAGCACAACCGGCTGGCCACCGAGCTGAGACGACTGAATCCCCGGTGGAATGGAGACAAACTGTACAATGAG
G
CTCGGAAGATCATGGGGGCCATGGTCCAGGTAAGGAGCTCTGCATCCCAGCATCCCCCAGATGACAAGCTTGGCATGAGAAGCAGTCCTTAACACATCCTTGCGGATGTGCCTAAAACCA
GCTGGGTCTGGGCAACTGGCGGAGCACCTGGACCTGTCCTCTTGCCCCGATTCTGCCTCTAACTCCCTGTGTGACCCTGTCTGTGTCACTCACCCTCTCTGGGCTTTGTATCTCCACCCA
CCAATAGGAAATTAATGTTGTCACATTTGACGTGATGACAATAAAGAATATGTCTGAGCCACCCTTTGAAAAGGCAAGGGTATGGGTGAGTAGCCTCTGGGGAATGTTCCTCCTGTCTTC
CCTTCCAGATCATCACCTACCGAGACTTTCTGCCCCTGGTTCTGGGCAAGGCCCGGGGCAGGAGAACCCTGGGGCCCTACAGGGGGTACTGCTCCAATGTGGACCCACGGGTGGCCAATG
TCTTCACCCTGGCCTTCCGCTTTGGCCACACAATGCTCCAGCCCTTCATGTTCCGCTTGGACAGTCAGTACCGGGCCTCCGCACCCAACTCGCATGTCCCACTTAGCTCTGCCT
TCTTTG
CCAGCTGGCGGATCGTGTATGAAGGTGACCAGGTTTTCCAGGGGGCAAATGGGGGTGAGGGTGGGGAGCATGCCCTCCCCTAGGTGGGCCAAGCTTACTGCCAGGAAGCCAGGCTGCTGC
AGAGGCCACTGCTAATATCTCCCCAGGACAGTGGAAACAAGGCAGGTGCCAGCAAGACCCTCAGTCACAGGCCTCCCATCCTCTGTGGAATGAGAGGATTTTTTAAAGGGGTGGAGACTA
ATGTCAGATTGATGGGGAGCTCACCTTCCATTCCTTAAGAAGTACCTCCCAGCTCCAGCTGCTTCATGTCTCTCCAGAACTCTGTTTCCTGACAAACGTTACTAACATACCCGACTGGCT
TGTCCAGCTCTGGGCTAGCTTGGCATCATGTGATAACCCAAGTAGCTTCCCAGAGGCTGGTCCAATCTGTGCTGCTCACATTCCCTGCCACCAGGGGGCATCGACCCCATCCTCCGGGGC
CTCATGGCCACCCCTGCCAAGCTGAACCGTCAGGATGCCATGTTAGTGGATGAGCTCCGGGACCGGCTGTTTCGGCAAGTGAGGAGGATTGGGCTGGACCTGGCAGCTCTCAACA
TGCAA
CGAAGCCGGGACCACGGCCTTCCAGGTGAGGGGGCTGTCCACCTCTTCTCCCAGCTTTGCTTAGGCCAGGCTGCTCAAGGGGTTCTGGGAAGACCCTGGTACCTCCTTTCTGACTGGGAC
TGTCTACAGGATGTGCAGGAGTGCAGAGGCATGCAAGGCCAAGGTCGATGTCCCAAAGCACTCCTGGAACACCGCTTGCTGTCCTGCCATGGCTCCCCCATCCACTGTAGGGGCTCCAGT
TTTAGGTTCACCACAGGACCAGGACTTAGGCTCAGGAGCTGAAAAAGGGAGGCTCGAACTTTCCAAGTAGAAAAAAAGCAATAGGCTTAAAAGGCAGGGAAGAACTGCTCCATTCCCAAC
ACGCTGGCAAGTTCCAAGGAGGAAGGCTAAAATTCCAGAGCTACAGAAACGCTCCTTGCTCTAAGTGGAGAAAGGCAAAGAGCCTTAGAGGCAGGGAATAGGTGGAATAAAACTAAGGCT
GCAGTGGCTATTTGGTGAGGGCACAAATGACTTTATCCCAGGAAAGAAGAAAATGTAGGCACTTTGTTAGTCACTTTCATGTATATTAATTTATTTTGTCCTCCCAATCACCTTGAGAAG
CAAATGATTACAGCCATTTTGTAGATGAGAAACTATGTTCAGAGACAGCTAGTAATTTGCCCAAGATCACATAAATAAGAAGTAGTAAAATCTGAATTTAAATTTACAATTTCTCCTTTC
TTCCCCCTGTTCAACCCCAGTAGGGGAAGGTTTTGGCCACTGCCTTGCTCCTCTCTCCTTCCCACCTCCTACCTCCCTGTCTAGAAAGAACCTGAAGGCCCATCTGCCCATGTATGAAGC
AGTGGCGGCACCTCCTACTGCCCACCCCACTTCACACAGTGCCTGGTAGAGCACAGCAGGCACTCCGGAAACCTGAGCTTCTTTCCTTTCTTAAACTTGGGCGCTCCTGGCAGCTAAGGA
GCTGTGGGCGCCCCCTGCTGGAGAGCTGAGATCGCTAGCCATCCAAGTTTCTATTAGGTTTTGAAGGGAAGGCAGGGGTTAAGGAAAGACACAGAGAGAGAGGGGGCTCAACAGCCAATG
CAGGTATTTATTTCCAGCATAAAACCTACAGAGGTGGGGGACCAGCTTATTGCCAGAGCCTGCCGCCGCCTACAGCTGGGGTACTGGGTATGGGTATGGGCAGGAGGGGTCTGGGTCGTA
TGGCTTGCTGCCCAGCAGGATATTGATAAGATGTATCTATGATCAGGTCCTTTTTTCAGTGGGATGTGGTAAGATGTTCCTTGGACCTTTGCCCAGCAGGATATGATAGGGATGTTCCTT
CAGTTGGGCCTTTGCCCATTAGGGTATGTTATGTTTTTCACGGCCCGACCTCCTGTGGAACGTTTCACATTGACCAAGGTCTGGGAAATGGTGGGGGGCTTACAAAATGGTGCAGTTTGG
ACTAACATTCTTGCCTTCTACTTTGATATAAAAGGAAGAGCTGGAGAGCTGAGATCGCTAGCCACCCAAGTTTCCACATTGCGAGCTTCTGCTCCCCGCAATACCTGTGCCCTCCAGAAA
TATTATCCTGACACTAGCTCTTGCAATCTCCTCTAATCCCTTCCCAAGTCCAACATCAAACTGGGAACTGGACAACCTGGTTTGAGCTCCACTTAACAGTAAAGTGACCCTGAAGCCTAT
GGTTGCTCAACTTTAGTAAACATACCAGATATAGTTAGCATGCCATAAAAGCACCTCACAAAGGTGCTGTGAGGGTCCTGAGATATTCACCCAATAGTGCTCAGTAATGGTAAAATACTG
TGTGGTTTTCATGTGTTCCGCTGGGGGATGGTGTGTGTGAGCTGTAGTTCAATGGATGACATTGGGCTGGTGTTCTTTCGGGACATGGCAAAGCTATCTCCTACCTTGATTGTCACATCT
TATGATGTGGCTTGGCCCTGTGTGGGATCCTGATGGCTGACAAATTGGTATGGCTGGTCTTTGGGAGTTTCTGAAAACTTTTTAAAAACTGCTTTATTGAGATGTACCATAAAATTCACC
CATATGAAATAGACAATTCAATGATTTTAGTGTATTTAGAGTTATGCACCCATCACCATGATCTAATATCACACCATTTTCATCACTCCCCAAAGAAACCTTGTAAGAACAGTCAATCCC
CATCCCCACCCCAGCCCCAATCACCTCTAATATACTTTGTGTCTCTATATTGGCCTATGCAGGAACTCTCATATCAACGGAATCATAGTGTGCCGTCCTTTTCTGAGTAGATGAATTTTA
TCATTGCTCTCCATTTGTTCGCTTGTTCATTCATTTATTCATTCGCTCATTCATTCATTCTACAAACCTGATGGAGAGTCTTTTATATTCTGGGTACTGTCTTACTTGTGTCTAATGAAT
GCAGTCGAGCCCAGTAATATCACTAAGTGTCGGATTTGTGGTTATGAGTTTTGGGTTAAAACCCCTTTTTAGGTTAGGACACACTCCTCAGTCTGATGCACACTGAGCATGGTTGTCCAC
TCACATTTTCAATCAGAGGACAGAAACCTGGTCTTTGGAAGGTCTAGGGACTCTTCTGCCAGCAGGATCTTCTGGTTCTGCCCAATATTGACTGGCCACAGCTTCCCCCCAGAGGACTGG
TGGAGAGAAACAGAAGCTAATGGGAGGTCAGCAAGACTGAAGCTGCTTCTCCCCATTCCCCTGCAGGGTACAATGCTTGGAGGCGCTTCTGTGGGCTCTCCCAGCCCCGGAATTTGGCAC
AGCTTAGCCGGGTGCTGAAAAACCAGGACTTGGCAAGGAAGTTCCTGAATCTGTATGGAACACCTGACAACATTGACATCTGGATTGGGGCCATCGCTGAGCCTCTTTTGCCAGGGGCTC
GAGTGGGG
CCTCTTCTGGCTTGTCTGTTCGAGAACCAGTTCAGAAGAGCCCGAGATGGAGACAGGTAAGTGACCCTATCATAAAAGACATCAGCACCAGAGGCAGAGCAGAAAAACACTA
GCATTTCAAGACTAAACATTGAAGAACATTGCTCTTTTTAGTATCATTTCTTCCAAGTTCACAGGATCTGAAATCAGGAGGCTCCTCTCTGAAAAGCCGGGTCAAAGGAAGAGAGACACT
GACCCAGGCAAGGCCCATATTGCCTGAGCTGGAGTCATCTTAAACCCAGGAGGTTGCCTGGAAGCCTCACTGTTCTGGGTTGGTGGATCCCAGAAAACATGGGCAGAAAGGGCTAAATCT
GGTTTCCCTCCAATACATTTGTGATTTAAGACCTGACTCCTTATTTGGAGTTGGTATTGCCCGAGTTCAAATCCAGCCCTGGCCACTTAACTTACTGTGCACTTAATACAGGGCAATTTA
TTTGGCCACTGAATTTGTTTCATTTCTGAGATTCCAATCTTGCAGGAATTTTGTGAGAATTGAATGGAATAATATATGTAAAGTACCTGGCACACAACAGGTGCTCATTACAAGGTAATT
CCTCCCCAACCTTCACCCACATCTCTCGACTGCCTGGTAGGTTCTGGTGGCAGAAACGAGGTGTTTTCACCAAAAGACAGCGCAAGGCCCTGAGCAGAATTTCCTTGTCTCGAATTATAT
GTGACAATACCGGTATCACCACGGTTTCAAGGGACATCTTCAGAGCCAACATCTACCCTCGGGGCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATCTGCTCCCAGCCCTGGCAGGGGTCCTGGCCACACTCGTCCTTGCCCAGCCCTGTGAGGGCACTGACCCAGCCTCCCCTGGGGCAGTGGAGACCTCGGTCCTGCGAGACTGCATA
GCAGAGGCCAAGTTGCTGGTGGATGCTGCCTACAATTGGACCCAGAAGAG
CATCAAGCAGCGGCTTCGCAGCGGTTCAGCCAGCCCCATGGACCTCCTGTCCTACTTCAAACAACCGGTA
GCAGCCACCAGGACAGTTGTTCGGGCCGCAGATTATATGCATGTGGCCTTGGGGCTGCTTGAAGAGAAGTTACAACCCCAGCGGTCCGGACCCTTCAATGTCACTG
ATGTGCTAACAGAA
CCACAGCTGCGGCTGCTGTCCCAGGCCAGTGGCTGTGCTCTCCGGGACCAGGCCGAGCGCTGCAGCGACAAGTACCGCACCATCACCGGACGATGCAACAACAA
GAGGAGACCCTTGCTA
GGGGCCTCCAACCAGGCTCTGGCTCGCTGGCTGCCCGCCGAGTATGAGGATGGGCTGTCGCTCCCCTTCGGCTGGACCCCCAGCAGGAGGCGCAATGGCTTCCTTCTCCCTCTC
GTCCGG
GCTGTCTCCAACCAGATTGTGCGCTTCCCCAATGAGAGACTGACCTCCGACCGTGGCCGGGCCCTCATGTTCATGCAGTGGGGCCAGTTCATTGACCATGACCTGGACTTCTCCCCGGAG
TCCCCGGCCAGAGTGGCCTTCACTGCAGGCGTTGACTGTGAGAGGACCTGCGCCCAGCTGCCCCCCTGCTTTCCCATCAAG
ATGACCCCCGCATCAAGAACCAGCGTGACTGCATCCCTT
TCTTCCGCTCGGCACCCTCATGCCCCCAAAACAAGAACAGAGTCCGCAACCAGATCAACGCGCTCACCTCCTTTGTGGACGCCAGCATGGTGTATGGCAGTGAGGTCTCCCTCTCGCTGC
GGCTCCGCAACCGGACCAACTACCTGGGGCTGCTGGCCATCAACCAGCGCTTTCAAGACAACGGCCGGGCCCTGCTGCCCTTCGACAACCTGCACGATGACCCCTGTCTCCTCACCAACC
GCTCGGCACGCATCCCCTGCTTCCTGGCAGGTCAGACAGG
TGCAGTAAATCTGAGCTTGGGGTTTTCAAGGTGACACCCGATCAACGGAAACCCCCAAACTGGCAGCCATGCACACCCTC
TTTATGCGAGAGCACAACCGGCTGGCCACCGAGCTGAGACGACTGAATCCCCGGTGGAATGGAGACAAACTGTACAATGAG
GGGGAATGTTCCTCCTGTCTTCCCTTCCAGATCATCACC
TACCGAGACTTTCTGCCCCTGGTTCTGGGCAAGGCCCGGGGCAGGAGAACCCTGGGGCCCTACAGGGGGTACTGCTCCAATGTGGACCCACGGGTGGCCAATGTCTTCACCCTGGCCTTC
CGCTTTGGCCACACAATGCTCCAGCCCTTCATGTTCCGCTTGGACAGTCAGTACCGGGCCTCCGCACCCAACTCGCATGTCCCACTTAGCTCTGCCT
ATCTGTGCTGCTCACATTCCCTG
CCACCAGGGGGCATCGACCCCATCCTCCGGGGCCTCATGGCCACCCCTGCCAAGCTGAACCGTCAGGATGCCATGTTAGTGGATGAGCTCCGGGACCGGCTGTTTCGGCAAGTGAGGAGG
ATTGGGCTGGACCTGGCAGCTCTCAACA
CAGAAGCTAATGGGAGGTCAGCAAGACTGAAGCTGCTTCTCCCCATTCCCCTGCAGGGTACAATGCTTGGAGGCGCTTCTGTGGGCTCTCCC
AGCCCCGGAATTTGGCACAGCTTAGCCGGGTGCTGAAAAACCAGGACTTGGCAAGGAAGTTCCTGAATCTGTATGGAACACCTGACAACATTGACATCTGGATTGGGGCCATCGCTGAGC
CTCTTTTGCCAGGGGCTCGAGTGGGG
TCATTACAAGGTAATTCCTCCCCAACCTTCACCCACATCTCTCGACTGCCTGGTAGGTTCTGGTGGCAGAAACGAGGTGTTTTCACCAAAAGAC
AGCGCAAGGCCCTGAGCAGAATTTCCTTGTCTCGAATTATATGTGACAATACCGGTATCACCACGGTTTCAAGGGACATCTTCAGAGCCAACATCTACCCTCGGGGCT

Retrieve as FASTA