Entry information : AtPrx01 (At1g05240 / PER1 / Atp11a / Atatp11a / AtP11)
Entry ID 77
Creation 2006-07-20 (Filippo Passardi)
Last sequence changes 2012-06-05 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-11-04 (Christophe Dunand)
Peroxidase information: AtPrx01 (At1g05240 / PER1 / Atp11a / Atatp11a / AtP11)
Name (synonym) AtPrx01 (At1g05240 / PER1 / Atp11a / Atatp11a / AtP11)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue type Roots hairs
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx01
start..stop
S start..stop
AtPrx02 665 0 1..325 1..325
AlyPrx02 515 0 1..325 1..321
AlyPrx01 515 0 1..325 1..321
CrubPrx51 506 0 1..325 1..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1521202..1521414 213 N° 2 1521504..1521689 186 N° 3 1521783..1521948 166 N° 4 1522035..1522447 413
join(1521202..1521414,1521504..1521689,1521783..1521948,1522035..1522447)


exon

Literature and cross-references AtPrx01 (At1g05240 / PER1 / Atp11a / Atatp11a / AtP11)
Literature REFERENCE 1 Kim BH, Kim SY, Nam KH. Genes encoding plant-specific class III peroxidases are responsible for increased cold tolerance of the brassinosteroid-insensitive 1 mutant. Mol Cells. 2012 Dec;34(6):539-48.
REFERENCE 2 Lan P, Li W, Lin WD, Santi S and Schmidt W Mapping gene activity of Arabidopsis root hairs Genome Biology201314:R67
Protein ref. UniProtKB:   P0DI10
DNA ref. Phytozome 12:   Chr1 (1521202..1522447)
mRNA ref. GenBank:   NM_100403.3
Cluster/Prediction ref. Phytozome Gene 12:   19657003 UniGene:   At.139
Omic ref. AtProteome:   At1g05240 ATTED-II:   At1g05240 e-FP Browser:   At1g05240 ePlant:   At1g05240 TAIR:   At1g05240
Protein sequence: AtPrx01 (At1g05240 / PER1 / Atp11a / Atatp11a / AtP11)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (304)
PWM (Da):   %s   35487.74 (33397.5) Transmb domain:   %s   i7-26o
PI (pH):   %s   9.73 (9.62) Peptide Signal:   %s   cut: 22 range:22-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAIKNILALVVLLSVVGVSVAIPQLLDLDYYRSKCPKAEEIVRGVTVQYVSRQKTLAAKLLRMHFHDCFVRGCDGSVLLKSAKNDAERDAVPNLTLKGYEVVDAAKTALERKCPNLISCADVLALVARDAVAVIGGPWWPVPLGRRDGRISKLNDALLNLPSPFADIKTLKKNFANKGLNAKDLVVLSGGHTIGISSCALVNSRLYNFTGKGDSDPSMNPSYVRELKRKCPPTDFRTSLNMDPGSALTFDTHYFKVVAQKKGLFTSDSTLLDDIETKNYVQTQAILPPVFSSFNKDFSDSMVKLGFVQILTGKNGEIRKRCAFPN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 3 introns). Identical to AtPrx02. Shorter, irregular, but more frequent root hairs in the mutant line Salk_10357C. Transcript and protein are referentially detected in root hairs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAAGTAATTT TCTGAAATTT TAATACTCTT AGATTATTTA TAATATGGAA AAAAATTATA TAGTTTTTTA ACTAAAATTC AATGACTTGT TATAGTTAAT ATTTATCTTT ATGAGATATA  AATTTAATTT TTACTTTCAA AAAATATGAC TATTATATTT TTAACTATTT TATTTTATTA TTATTTCATA TCTTTGTTAT AAATTTAATT GTAAAGAAGG AAAATTTCAT GATTCTTCTT  CCACATGGCA TTTTCTTAAA TATTATAGAA GTTTAGGTTG TATTATTGTT AGTCAGACAG AAGTTGATTG AGTGATGTAT TTATTTTATT TCATTTAAAA GAAGAAAATC TAAAAATCAT  CACCTTAATT TTGAGTTTTG TTTACGAAAC AATTGTTTTT TCAATTTAAG GAAGTCAATG AAATATCACT TTTTTCACAG TAAGACTTCA TTTTACATGC CTAGAAATAT TAATTACTTT  GTGGCCCAAG CATTTATAAC TATAACGTGC AATTAAGCTA TTTAAAATAC GGATCACCCA TTAAAAAGGT GATAATTTGT AAAAGCCATG CATTCATCTT AATTTATCAC GCGAATATAT  AGAGAAATAT ACTGCGTATT TAATTACCTA GTTCTTAAGC TTTGTTTTTT TTTTTAAAGT CCTTATAGCT ATAGCTTTAA CACTCAAGTT TTTCTTTTCA GTAAGTTTAT ACTTTACCTA  GATTCTTTAA AATAACTATA TATAAAAAAA CAATAACCCA ACTTATTTCT GATTTTTACT GTATATATGT AGGTACAGAT ATATAGATGG AGTTATACGT ACGTACGTAT GCGATAGGGT  GGCGAATAGT TTCGACGCAT TAAATGTGTA CACAGAGGCT GCATGGGCTT TAGGCCATTT ACTGCTCTCA TGCCTCTCTT GCACTTTAAC CTCCTCTTCC TTCTTCGTAC TCTCCTACTA  AAAAAAACTA GTAATTCAAC GCCTAACATT TTAGTTTTTT CTTTTTTTTT TTTTTTTTTT TTTAGTTTTT TCTTTTTTCC TGCTACATCA CTAAAAGTTA ATTATTTCAA AAAAGAATTG  CTACAATACT ATTCACATTT TAAGTTTGTT TCATCCTCGT AAGTCTCAAA TATTTATTTT TAGTTTATTT CTTTTTTTTG TCAAACTTTT AGTTTATTTC AATTAGTGTT TTTTCTGCCA  ATATGATCAA ATCTGAGATT CAAAATGGAA TTCTTCTGTT GAAAAAATGG ATGCTTTTGT AATAAATTCA AGATCGTAGT TTTTTTTTGT TTCTGGGCTT CGTATATGGG CCATAAGACG  GAAGTAAACT TTTGGCCCAT TATATATTTT ATCCCCAACG AGAATGGCAA GGCCGAAAGT CTCATTCTCC GAGAGTGGAA AGTTAGTTAA GGAAAATGAT TGATTTTTTT GTTTTGTTTT  GCATTAGTCT ATAGGACGAC TTGTTTCACA AGAAACTAGC CGTATATTGT AATATCCAAT CACTGAATTG AGCAACTTGG ATAGTTTACA TTGAGAATGC AGGAACGTGG ATTCCACAAA  CTATAACAGT TTATTATAGT TTTTAACTTT TGAGAGCTAA GGACTAATAA AAAAATTCCC CAAACTACAT CTTCTCCAAA GTCAATAGCT TTTCAAAGCG CAAAAGATGA TTTGAAGCTT  TCTTAATCGT TGCATGATTT CGATTTCTTC TAATTGTGGA AATTTAATAT ATTTAATTGC AGCACCAGCA GAGATCAAGA AGATAGTGGA GGCCATGCAA TGTCCTCCTC GAGCTCCTCT  TGTATTTCAA CCCTCATTAA GAAACAGAGG AAAAATGCAA ATGGGATTAT CTAAATCTTG TTTGGCATTT CTCCATGGAC TATTTCAAAG CCGCTGGGTG ATCTATAAAA GGCCTGAGAA 
TGTCTCCTTC ATCTTCATCT CCAAAGCTCG TTCTCACCTT ACTTGGCAAA CACTCAACGA AGAAAGGAGA GAGAGACGGT A 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTGGATCGA TCAGACCGGG TTTCGGATGA TTTTGAGTCT ACACGTTTTT CTCTGCTTAT TTTCTTTCTT TTTCTTTTTT CTTTCACGGA AGTTTGAGCT TTGGTGTTGT CTTCTTCTGT  TTCTTCCATG AATAATTGTT TTTTGTTGAG TAACTTTACA TTTGTATTCT TTACGGTGAC TGTGTTTTGT AATGGAAAAA GTTTGTTTCG AATTCATCCG TTAAACGTAA ACCTAAATTA  AACAAAAATT ATAATTGGAA AGCAAAACAT TTTGTAAGCT TCGTGGTGTT TTTACTATGA ATTAATATTT ATGTTTGTTT TTCACGGTTA ATGGTTATGG TTATTAACCG TTTTAATAAT  TTATTTTCAC GGTTAATGGT TACAATAATA AATGATCTAT TTTCACGGTT AATGGTTACG GTTATTAACC GTTTTATACG GTTATGATTA CGGTCGGGGT ATGGTTAATA AACGGTCTGG  TTACGATCCA AAATACGGTT ACGGTTAGAA TTTGGTCATA CTTTGATGAC ACCTTTTAGG GGTTTGGATG TTGTGTCCAA TTAGTTTACA AAAAATTGAA AATTTAACAC TTATAAGAAA  AAACCTTTTA GTTTTAATAG TAGTAATATA AAAATATTGT TTAAAAAACA TTTTTAAATA AAATAAAAAT ATTGTTTTAA AAACATTTTT AAATAAAATA AAAATAAGTG TTAAAAAGTT  AAATTAGGTG TAAACTATAT TGAACCGATG ACGCCTCTTA GGGGTTTGGA CGTTGTGTCC AATTAGTTTA CACAAAATTT AAAAATTTAA CACATATAAG AAAAAACTTT AAAGTTTAAA  AACCTTATAG TTTTAATAGT ATTAATACAA AATATAGTTT TAAAAACATT TTTAAATAAA ATAAAAATAA GTGTTAAAAA GTTAAATTAG GTATAAACCA TATTGAACCG ATGACGCCTC 
TTAGGGGTTT GGACGTTGTG TCCAATTAGT TAACACAAAA T 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATCAAGAACATTCTCGCCCTTGTGGTTCTTCTTAGCGTGGTTGGAGTTTCTGTCGCCATTCCACAGTTGCTTGACCTCGACTACTACCGGTCTAAGTGTCCCAAGGCAGAGGAA
ATTGTTCGTGGTGTCACAGTACAATATGTTTCTCGCCAGAAAACCCTTGCCGCTAAACTTCTAAGGATGCATTTCCATGATTGTTTCGTCAGA
GTAAGCTTGGTTCACTTGTTCGAGACT
GTTAACCAAGGGATATGAAAAAACTAGCTAGTCCTAACACTCTTTTGTAATGATTCATGTAGGGATGTGATGGTTCCGTTCTTCTGAAATCTGCAAAGAATGATGCGGAAAGAGACGCTG
TCCCCAACCTGACCCTGAAAGGTTATGAAGTGGTGGATGCGGCCAAGACAGCGCTGGAGAGGAAGTGTCCTAATCTCATTTCTTGCGCTGATGTTCTTGCCTTGGTCGCCAGAGATGCCG
TGGCAGTG
GTAACATTCCATTTTCGCAATGGACTAGTGATTTTGTCATTCCAAAACTGAAGACTATAGTATGTATATAACTTATTAATTGTCTTTGAACAGATCGGGGGACCATGGTGGC
CGGTTCCATTGGGCCGCAGGGATGGACGCATCTCGAAATTGAACGATGCATTGCTAAATTTACCATCTCCTTTCGCCGACATAAAGACGCTGAAGAAGAACTTTGCCAACAAGGGTCTTA
ACGCTAAAGACCTTGTGGTTCTCTCAG
GTATGTCTGCAGCTGGCACCTTATGATGTGCAATTCTCAAAAGAGTTATCAATTTGAAAGCTGAACAAAAATGGTTTCTTGAGTAGGGGGTCA
CACCATTGGAATCTCTAGTTGCGCTCTCGTCAACAGTCGTCTCTACAACTTCACAGGAAAGGGCGATTCTGACCCATCCATGAACCCTAGCTACGTGAGGGAATTGAAGAGAAAGTGCCC
GCCTACAGATTTCAGAACCTCACTGAACATGGACCCAGGCAGTGCGTTGACATTCGACACTCACTACTTCAAGGTCGTGGCTCAGAAGAAAGGGCTCTTCACATCTGACTCTACGCTTCT
CGATGACATTGAGACCAAAAACTACGTTCAGACTCAGGCCATTCTCCCTCCTGTGTTTTCTTCTTTCAATAAAGATTTCTCCGATTCCATGGTCAAACTTGGTTTCGTCCAAATTCTTAC
CGGCAAAAATGGTGAGATCAGGAAGAGATGCGCCTTCCCTAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATCAAGAACATTCTCGCCCTTGTGGTTCTTCTTAGCGTGGTTGGAGTTTCTGTCGCCATTCCACAGTTGCTTGACCTCGACTACTACCGGTCTAAGTGTCCCAAGGCAGAGGAA
ATTGTTCGTGGTGTCACAGTACAATATGTTTCTCGCCAGAAAACCCTTGCCGCTAAACTTCTAAGGATGCATTTCCATGATTGTTTCGTCAGA
GGATGTGATGGTTCCGTTCTTCTGAAA
TCTGCAAAGAATGATGCGGAAAGAGACGCTGTCCCCAACCTGACCCTGAAAGGTTATGAAGTGGTGGATGCGGCCAAGACAGCGCTGGAGAGGAAGTGTCCTAATCTCATTTCTTGCGCT
GATGTTCTTGCCTTGGTCGCCAGAGATGCCGTGGCAGTG
ATCGGGGGACCATGGTGGCCGGTTCCATTGGGCCGCAGGGATGGACGCATCTCGAAATTGAACGATGCATTGCTAAATTTA
CCATCTCCTTTCGCCGACATAAAGACGCTGAAGAAGAACTTTGCCAACAAGGGTCTTAACGCTAAAGACCTTGTGGTTCTCTCAG
GGGGTCACACCATTGGAATCTCTAGTTGCGCTCTC
GTCAACAGTCGTCTCTACAACTTCACAGGAAAGGGCGATTCTGACCCATCCATGAACCCTAGCTACGTGAGGGAATTGAAGAGAAAGTGCCCGCCTACAGATTTCAGAACCTCACTGAAC
ATGGACCCAGGCAGTGCGTTGACATTCGACACTCACTACTTCAAGGTCGTGGCTCAGAAGAAAGGGCTCTTCACATCTGACTCTACGCTTCTCGATGACATTGAGACCAAAAACTACGTT
CAGACTCAGGCCATTCTCCCTCCTGTGTTTTCTTCTTTCAATAAAGATTTCTCCGATTCCATGGTCAAACTTGGTTTCGTCCAAATTCTTACCGGCAAAAATGGTGAGATCAGGAAGAGA
TGCGCCTTCCCTAACTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATCTCCAAAG CTCGTTCTCA CCTTACTTGG CAAACACTCA ACGAAGAAAG GAGAGAGAGA CGGTAATGGC GATCAAGAAC ATTCTCGCCC TTGTGGTTCT TCTTAGCGTG GTTGGAGTTT  CTGTCGCCAT TCCACAGTTG CTTGACCTCG ACTACTACCG GTCTAAGTGT CCCAAGGCAG AGGAAATTGT TCGTGGTGTC ACAGTACAAT ATGTTTCTCG CCAGAAAACC CTTGCCGCTA  AACTTCTAAG GATGCATTTC CATGATTGTT TCGTCAGAGG ATGTGATGGT TCCGTTCTTC TGAAATCTGC AAAGAATGAT GCGGAAAGAG ACGCTGTCCC CAACCTGACC CTGAAAGGTT  ATGAAGTGGT GGATGCGGCC AAGACAGCGC TGGAGAGGAA GTGTCCTAAT CTCATTTCTT GCGCTGATGT TCTTGCCTTG GTCGCCAGAG ATGCCGTGGC AGTGATCGGG GGACCATGGT  GGCCGGTTCC ATTGGGCCGC AGGGATGGAC GCATCTCGAA ATTGAACGAT GCATTGCTAA ATTTACCATC TCCTTTCGCC GACATAAAGA CGCTGAAGAA GAACTTTGCC AACAAGGGTC  TTAACGCTAA AGACCTTGTG GTTCTCTCAG GGGGTCACAC CATTGGAATC TCTAGTTGCG CTCTCGTCAA CAGTCGTCTC TACAACTTCA CAGGAAAGGG CGATTCTGAC CCATCCATGA  ACCCTAGCTA CGTGAGGGAA TTGAAGAGAA AGTGCCCGCC TACAGATTTC AGAACCTCAC TGAACATGGA CCCAGGCAGT GCGTTGACAT TCGACACTCA CTACTTCAAG GTCGTGGCTC  AGAAGAAAGG GCTCTTCACA TCTGACTCTA CGCTTCTCGA TGACATTGAG ACCAAAAACT ACGTTCAGAC TCAGGCCATT CTCCCTCCTG TGTTTTCTTC TTTCAATAAA GATTTCTCCG  ATTCCATGGT CAAACTTGGT TTCGTCCAAA TTCTTACCGG CAAAAATGGT GAGATCAGGA AGAGATGCGC CTTCCCTAAC TAATTTGGAT CGATCAGACC GGGTTTCGGA TGATTTTGAG  TCTACACGTT TTTCTCTGCT TATTTTCTTT CTTTTTCTTT TTTCTTTCAC GGAAGTTTGA GCTTTGGTGT TGTCTTCTTC TGTTTCTTCC ATGAATAATT GTTTTTTGTT GAGTAACTTT 
ACATTTGTAT TCTTTACGGT GACTGTGTTT TGTAATGGAA AAAGTTTGTT TCGAATTCAT CCGTTAAACG TAAACCT 

Retrieve as FASTA