Entry information : ZmPrx67
Entry ID 777
Creation 2006-02-02 (Christophe Dunand)
Last sequence changes 2011-02-23 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-02-23 (Christophe Dunand)
Peroxidase information: ZmPrx67
Name ZmPrx67
Class Class III peroxidase    [Orthogroup: Prx129]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx67
start..stop
S start..stop
ZmPrx36 587 0 1..322 1..325
SbPrx72 530 0 27..320 26..321
BdiPrx97 502 0 5..320 8..324
SiPrx78 498 5e-180 21..320 21..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 145510038..145510250 213 N° 2 145509745..145509939 195 N° 3 145509072..145509632 561  
complement(join(145509072..145509632,145509745..145509939,145510038..145510250))


exon

Literature and cross-references ZmPrx67
Literature Walbot,V., unpublished
Cluster/Prediction ref. UniGene:   Zm.29242
Protein sequence: ZmPrx67
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (298)
PWM (Da):   %s   32658.07 (30438.8) Transmb domain:   %s   i5-27o
PI (pH):   %s   4.73 (4.52) Peptide Signal:   %s   cut: 25 range:25-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARRLLAAVAIVVVAAALACGAGAQLSAGFYSSSCPAVHSIVRQAMSQAVTNNTRSAAAVLRVFFHDCFVNGCDASLLLDDTPTTPGEKGAGPNAGGSTVGFDLIDTIKAQVEAACPATVSCADILALTARDGVNLLGGPSWAVPLGRRDATFPNSTGAATDLPGPDSDLAGLVAGFAAKGLSPRDLAALSGAHTVGMARCASFRTRVYCDDNVSPAFAAQQRQACPSADADDALAPLDSLTPDQFDNGYYRSLMAGAGLLHSDQELFSNGALDSLVRLYGTNADAFSSDFAASMVKLGNIGPLTGSAGEVRLNCRTVNSNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, introns 1 and 2) and 2 EST. This peroxidase differs from ZmPrx36 by only 3 amino acids.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGGCGGCTGCTGGCGGCGGTCGCCATAGTAGTCGTGGCCGCCGCGCTCGCGTGCGGCGCGGGCGCGCAGCTCTCGGCGGGGTTCTACTCGTCGAGCTGCCCCGCCGTGCACAGC
ATCGTGCGCCAGGCCATGTCGCAGGCCGTCACGAACAACACGCGCAGCGCCGCCGCCGTGCTCCGCGTCTTCTTCCACGACTGCTTCGTCAAT
GTGAGCAAGAGCGACCATGCCTTGCTT
ATTCGTTCAATATACTATAGTACTGTACTGTATGTCATCCGATGGCCGTTCGTGTTCCCCCCCTGCTGCAGGGCTGCGACGCCTCGCTGCTGCTGGACGACACGCCCACGACGCCCGGCG
AGAAGGGCGCCGGCCCCAACGCCGGCGGCTCCACCGTCGGCTTCGACCTCATCGACACCATCAAGGCGCAGGTCGAGGCCGCCTGCCCCGCCACCGTCTCCTGCGCCGACATCCTGGCGC
TCACCGCGCGCGACGGCGTCAACCTG
GTCTCTGTTCGTTCCGTGCCTTGCTTTTCCCCCCAATCGATGACGTAGTGTAGTATTCTCTATCTGCTCTCCTCTCCTTCTCCTCTGGGGCGTC
AACCTGGACTTGTGGCAGCTCGGCGGCCCGAGCTGGGCCGTGCCGCTGGGCCGGCGCGACGCGACGTTCCCCAACAGCACGGGCGCGGCGACGGACCTCCCGGGCCCGGACTCCGACCTG
GCCGGCCTGGTGGCCGGGTTCGCCGCCAAGGGCCTGAGCCCGCGCGACCTCGCGGCGCTGTCGGGCGCGCACACGGTGGGGATGGCGCGCTGCGCCAGCTTCCGCACCCGCGTCTACTGC
GACGACAACGTGAGCCCGGCGTTCGCCGCGCAGCAGCGCCAGGCCTGCCCGTCGGCCGACGCCGACGACGCGCTCGCGCCGCTCGACTCGCTCACCCCCGACCAGTTCGACAACGGCTAC
TACCGGAGCCTCATGGCCGGCGCCGGCCTGCTGCACTCGGACCAGGAGCTCTTCAGCAACGGCGCACTCGACTCGCTCGTGCGCCTCTACGGCACCAACGCCGACGCCTTCTCGTCGGAC
TTCGCCGCGTCCATGGTCAAGCTCGGCAACATCGGCCCGCTCACGGGTTCCGCGGGGGAGGTCAGGCTCAACTGCAGGACGGTGAATTCGAATTCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGGCGGCTGCTGGCGGCGGTCGCCATAGTAGTCGTGGCCGCCGCGCTCGCGTGCGGCGCGGGCGCGCAGCTCTCGGCGGGGTTCTACTCGTCGAGCTGCCCCGCCGTGCACAGC
ATCGTGCGCCAGGCCATGTCGCAGGCCGTCACGAACAACACGCGCAGCGCCGCCGCCGTGCTCCGCGTCTTCTTCCACGACTGCTTCGTCAAT
GGCTGCGACGCCTCGCTGCTGCTGGAC
GACACGCCCACGACGCCCGGCGAGAAGGGCGCCGGCCCCAACGCCGGCGGCTCCACCGTCGGCTTCGACCTCATCGACACCATCAAGGCGCAGGTCGAGGCCGCCTGCCCCGCCACCGTC
TCCTGCGCCGACATCCTGGCGCTCACCGCGCGCGACGGCGTCAACCTG
CTCGGCGGCCCGAGCTGGGCCGTGCCGCTGGGCCGGCGCGACGCGACGTTCCCCAACAGCACGGGCGCGGCG
ACGGACCTCCCGGGCCCGGACTCCGACCTGGCCGGCCTGGTGGCCGGGTTCGCCGCCAAGGGCCTGAGCCCGCGCGACCTCGCGGCGCTGTCGGGCGCGCACACGGTGGGGATGGCGCGC
TGCGCCAGCTTCCGCACCCGCGTCTACTGCGACGACAACGTGAGCCCGGCGTTCGCCGCGCAGCAGCGCCAGGCCTGCCCGTCGGCCGACGCCGACGACGCGCTCGCGCCGCTCGACTCG
CTCACCCCCGACCAGTTCGACAACGGCTACTACCGGAGCCTCATGGCCGGCGCCGGCCTGCTGCACTCGGACCAGGAGCTCTTCAGCAACGGCGCACTCGACTCGCTCGTGCGCCTCTAC
GGCACCAACGCCGACGCCTTCTCGTCGGACTTCGCCGCGTCCATGGTCAAGCTCGGCAACATCGGCCCGCTCACGGGTTCCGCGGGGGAGGTCAGGCTCAACTGCAGGACGGTGAATTCG
AATTCGTGA

Retrieve as FASTA