Entry information : ZmPrx69 (GRMZM2G080183 [6a])
Entry ID 779
Creation 2005-12-05 (Christophe Dunand)
Last sequence changes 2010-12-23 (Marie Brette (Scipio))
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-07-02 (Christophe Dunand)
Peroxidase information: ZmPrx69 (GRMZM2G080183 [6a])
Name (synonym) ZmPrx69 (GRMZM2G080183 [6a])
Class Class III peroxidase    [Orthogroup: Prx114]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Roots
Inducer Drought
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx69
start..stop
S start..stop
SbPrx143 568 0 37..331 40..336
SiPrx27 565 0 32..331 21..325
OsPrx90 545 0 29..331 31..337
HvPrx71 524 0 33..331 46..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 53398396..53398629 234 N° 2 53398106..53398297 192 N° 3 53396903..53397068 166 N° 4 53396354..53396757 404
complement(join(53396354..53396757,53396903..53397068,53398106..53398297,5339839 6..53398629))


exon

Literature and cross-references ZmPrx69 (GRMZM2G080183 [6a])
Literature Bohnert,H. et al., unpublished
Protein ref. UniProtKB:   B4FVT4   B6UI45
DNA ref. GenBank:   AC210686.2 (122651..124916)
mRNA ref. GenBank:   BT041222
Protein sequence: ZmPrx69 (GRMZM2G080183 [6a])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (306)
PWM (Da):   %s   35626.95 (32819.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.11 (8.72) Peptide Signal:   %s   cut: 26 range:26-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRSRRWHSVVAVALAAAAWWWCAAAQAQAQAQLSQSYYASTCPDVETLVRGAVTQKLQETFNAAPGTLRLFFHDCFVRGCDASVLLSGPDDEHSAGADTTLSPDALDLVTRAKAAVDADPRCANRVSCADILALAARDVVSQTGGPYYQVELGRLDGKVGTRAAVKHSLPGAGFDLDQLNKLFAANGLTQTDMIALSGGHTIGVTHCDKFVRRLYPFKGAAAGPPMNLYFLRQMRRTCPLNYGPSAFAMLDAVTPRAFDNGYYRTLQQMKGLLASDQVLFADRRSRATVNRFAANQTAFFDAFANAMAKLGRVGVKTAADGEVRRVCTRVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, 3 introns) and 25 ESTs. Also found in AC201748.4
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGTCGCGGCGGTGGCACAGCGTGGTCGCCGTAGCGCTGGCAGCGGCGGCGTGGTGGTGGTGCGCGGCGGCGCAGGCGCAGGCGCAGGCGCAGCTGAGCCAGAGCTACTACGCGTCG
ACGTGCCCCGACGTGGAGACGCTGGTCCGCGGCGCCGTCACCCAGAAGCTGCAGGAGACCTTCAACGCGGCGCCGGGCACGCTCCGCCTCTTCTTCCATGACTGCTTCGTCAGG
GTACGT
ACCCCGTCCGTCGTCGTGCTCCACGCTCGCCCGACTCTTGAGAGATGGTCCTGAGTCAGCTGACCGATCGACCTACTCCCCTCCCCTCACAGGGCTGCGACGCGTCCGTGCTGCTGTCGG
GCCCCGACGACGAGCACAGCGCGGGCGCCGACACCACGCTGTCCCCGGACGCGCTCGACCTGGTCACCCGCGCCAAGGCCGCCGTGGACGCCGACCCGCGCTGCGCCAACAGGGTGTCCT
GCGCCGACATCCTCGCCCTCGCCGCCCGCGACGTCGTCTCCCAG
GTACTGTGCTGTGCTGTGTGTTTCCTAGGCTAGGCCGGCCAGGCGGCGTGGCTTATTACGCTTAAACCTTACGCCA
TCAGCGCACCGTCGTGATAATAATAATCACCCATGCTTGCTACTAGTGCTTTGGAGTGGTTTACGGGGCATGTCAGGCGAGGCCCGGACGACAGCTATGATGAGGCTGCCCATGGCTGTC
TGTCCCCTCCCGCATGGGCGAACGAGTGCCGCAGCTGGAGCGCCCGATCCACGCTGCCAGGCGCAGTCGCTGACCCTGAGGCCTGAGCTGTGCCGCAAGTCCGCAACCATGCATCCTAGT
CCCGTCATGTCCAGCAACCAACCAGGCCTCTGACCGCAGAGGAGGGGGGAGGGAAGGGAAAAACAGGGGATTGGGTTTTTGTGTGTGTGTGTGTGTGTGTGTGGGCGGGGTGTGTGGTCG
TGGTCCTTGCTTGCTGCCCGTCCTGTCGTAATTCTGCTGTCCCCGGCTCATTCACTCGGAGCAACAAACAACACATCACAGATTCACAGCAAAGCACAGCACGCGGGCCAGAGCCAGACT
TCAGAGCTGGGTGTGGGTGCTGGCCGGCCGACGACGCCCGCCGTTTGTCACTGCTGCCTGCGTCCCCGCCCCCCCCCCCCCCCCCCCCCCCCCCCCCTTTGAATTCTTCTCTGACGACGG
CTGGGACAGCGGACACGGTTTCGCGGCGTAAATGAGCCGGTACGGCGACGGGGATGGTCCGGCACCTAATCCGCCGGGCTGGTGCGGTACCGCGCTGCCATTGCCTGTGCTGTGCGGCTA
CCTCCGTGCTCGTAGAAGATTACTGAGCTAGACATACGGGCCACCATACGGATACGGGCTCTCATTAGTTATTGTGCTGAGCAAGCAAGAGCAACTCCGCCGGAGTTTTCTTCTCTGACT
GCTCTGCGTGTAAAAAAGAAGAAGAAAAGAAAAGAGGATTTCACTGCATGAACGCAACTACTTATTACCGATGATGATGATGATGATGACGATGATGTGATGGTTGGGATTGGTGGTGCA
GACGGGCGGGCCGTACTACCAGGTGGAGCTGGGGCGGCTGGACGGCAAGGTAGGCACGCGTGCCGCGGTGAAGCACAGCCTCCCGGGCGCCGGCTTCGACCTGGACCAGCTCAACAAGCT
CTTCGCCGCCAACGGGCTCACGCAGACCGACATGATCGCGCTCTCAG
GTACGGCCGGCCTGCCATGCGGTTGCGGTCGCGGAACGCCGGACGGACGCGCGCGCGCGGCTCATCTCATCAT
TCCGCGCCTCGCCTCTCCTCTCTGTCGCTGACGCGCTGCCGCTTGCACCTGACATGACATGACACGACACAGGTGGGCACACGATCGGGGTGACGCACTGCGACAAGTTCGTGCGGCGGC
TGTACCCGTTCAAGGGCGCCGCCGCCGGCCCGCCGATGAACCTCTACTTCCTGCGGCAGATGCGGCGGACGTGCCCGCTGAACTACGGCCCGTCGGCGTTCGCGATGCTGGACGCCGTGA
CGCCCCGCGCGTTCGACAACGGCTACTACCGGACGCTGCAGCAGATGAAGGGCCTGCTGGCCTCCGACCAGGTGCTCTTCGCTGACCGCCGCTCCCGCGCCACCGTCAACCGCTTCGCCG
CCAACCAGACCGCCTTCTTCGACGCCTTCGCCAACGCCATGGCCAAGCTCGGCCGCGTGGGCGTCAAGACCGCCGCCGACGGCGAGGTCCGCCGGGTATGCACCAGGGTCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGTCGCGGCGGTGGCACAGCGTGGTCGCCGTAGCGCTGGCAGCGGCGGCGTGGTGGTGGTGCGCGGCGGCGCAGGCGCAGGCGCAGGCGCAGCTGAGCCAGAGCTACTACGCGTCG
ACGTGCCCCGACGTGGAGACGCTGGTCCGCGGCGCCGTCACCCAGAAGCTGCAGGAGACCTTCAACGCGGCGCCGGGCACGCTCCGCCTCTTCTTCCATGACTGCTTCGTCAGG
GGCTGC
GACGCGTCCGTGCTGCTGTCGGGCCCCGACGACGAGCACAGCGCGGGCGCCGACACCACGCTGTCCCCGGACGCGCTCGACCTGGTCACCCGCGCCAAGGCCGCCGTGGACGCCGACCCG
CGCTGCGCCAACAGGGTGTCCTGCGCCGACATCCTCGCCCTCGCCGCCCGCGACGTCGTCTCCCAG
ACGGGCGGGCCGTACTACCAGGTGGAGCTGGGGCGGCTGGACGGCAAGGTAGGC
ACGCGTGCCGCGGTGAAGCACAGCCTCCCGGGCGCCGGCTTCGACCTGGACCAGCTCAACAAGCTCTTCGCCGCCAACGGGCTCACGCAGACCGACATGATCGCGCTCTCAG
GTGGGCAC
ACGATCGGGGTGACGCACTGCGACAAGTTCGTGCGGCGGCTGTACCCGTTCAAGGGCGCCGCCGCCGGCCCGCCGATGAACCTCTACTTCCTGCGGCAGATGCGGCGGACGTGCCCGCTG
AACTACGGCCCGTCGGCGTTCGCGATGCTGGACGCCGTGACGCCCCGCGCGTTCGACAACGGCTACTACCGGACGCTGCAGCAGATGAAGGGCCTGCTGGCCTCCGACCAGGTGCTCTTC
GCTGACCGCCGCTCCCGCGCCACCGTCAACCGCTTCGCCGCCAACCAGACCGCCTTCTTCGACGCCTTCGCCAACGCCATGGCCAAGCTCGGCCGCGTGGGCGTCAAGACCGCCGCCGAC
GGCGAGGTCCGCCGGGTATGCACCAGGGTCAACTAG

Retrieve as FASTA