Entry information : AtPrx02 (At1g05250 / PER2 / Atp11a / Atatp11a / AtP11 / Atp12a)
Entry ID 78
Creation 2006-07-20 (Filippo Passardi)
Last sequence changes 2012-06-05 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-06-02 (Christophe Dunand)
Peroxidase information: AtPrx02 (At1g05250 / PER2 / Atp11a / Atatp11a / AtP11 / Atp12a)
Name (synonym) AtPrx02 (At1g05250 / PER2 / Atp11a / Atatp11a / AtP11 / Atp12a)
Class Class III peroxidase    [Orthogroup: Prx044]
Taxonomy Eukaryota Viridiplantae Streptophyta Brassicaceae Arabidopsis
Organism Arabidopsis thaliana    [TaxId: 3702 ]
Cellular localisation N/D
Tissue types Roots
Rosettes
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AtPrx02
start..stop
S start..stop
AtPrx01 665 0 1..325 1..325
AlyPrx02 515 0 1..325 1..321
AlyPrx01 515 0 1..325 1..321
CrubPrx51 506 0 1..325 1..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1526957..1527169 213 N° 2 1526682..1526867 186 N° 3 1526423..1526588 166 N° 4 1525924..1526336 413
complement(join(1525924..1526336,1526423..1526588,1526682..1526867,1526957..1527 169))


exon

Literature and cross-references AtPrx02 (At1g05250 / PER2 / Atp11a / Atatp11a / AtP11 / Atp12a)
Protein ref. UniProtKB:   Q67Z07
DNA ref. Phytozome 11:   Chr1 (1527169..1525924)
mRNA ref. GenBank:   NM_100404.3
Cluster/Prediction ref. Phytozome Gene 11:   19649246 UniGene:   At.139
Omic ref. AtProteome:   At1g05250 ATTED-II:   At1g05250 e-FP Browser:   At1g05250 ePlant:   At1g05250 Genevestigator:   At1g05250 TAIR:   At1g05250
Protein sequence: AtPrx02 (At1g05250 / PER2 / Atp11a / Atatp11a / AtP11 / Atp12a)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (304)
PWM (Da):   %s   35487.74 (33397.5) Transmb domain:   %s   i7-26o
PI (pH):   %s   9.73 (9.62) Peptide Signal:   %s   cut: 22 range:22-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAIKNILALVVLLSVVGVSVAIPQLLDLDYYRSKCPKAEEIVRGVTVQYVSRQKTLAAKLLRMHFHDCFVRGCDGSVLLKSAKNDAERDAVPNLTLKGYEVVDAAKTALERKCPNLISCADVLALVARDAVAVIGGPWWPVPLGRRDGRISKLNDALLNLPSPFADIKTLKKNFANKGLNAKDLVVLSGGHTIGISSCALVNSRLYNFTGKGDSDPSMNPSYVRELKRKCPPTDFRTSLNMDPGSALTFDTHYFKVVAQKKGLFTSDSTLLDDIETKNYVQTQAILPPVFSSFNKDFSDSMVKLGFVQILTGKNGEIRKRCAFPN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 3 introns), 10 cDNA and 41 ESTs (80% in roots only). Sequence is identical to AtPrx01.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCCAACAGTA GATTTTAGTG AGTTAGTAAC ATAGAAAGAT TAGCTGAATG TAATTAAAAG TATCGAGTGT TCTGATGTCA TAATCAACAA CTGTAATTTT TTTTATAACA TAATTGAGAT  TATATGGAAT CTTATTTTGG ATTCATTTAT TTTAGTCGCG ATCGAGTACT AGAATATTGG TAATCTTGAA TACTCTAAAT TTTTGGATGA TCAATCACCT CAAGACATAA CGTACTTTGA  TTTTTCACTG AAGAACAACT CGTTTTTGCC GACATCTTCC CATCCAAAAA AAAAAAAAAA ACTCGTTTCG AGAGTGATAT TTTTTTTAAT TCCAAAACTA CAATACGTAC TCGACCTAAT  CCGCAGTAGT ACAACTAAAA GAACCGCAAA AGAACAACTG CTAATGAGCA AGAGAGTATT CCAAGATTAT TAACCTTGTT TTATATTCTT AAGATCTTCT TTTTTTTTTA AGTTCTTTAA  TGTATAATAG AAGTATATAG GATTAACTGC GACTTGGTAG ATAGACTAAT TTCAGATGCT AAGATATACC ATATGGTAAT GATCCTAGTA AAATTACTTT TGTTAAACAT ATATGTACGA  ACAGTAGGAC ACGTATAGTC ATGTTTTCTG ATAGACGATT AGTGTTGCCG TTATATCATT ATCCGAATTA ATCTTGTAAT GCATGTTTTT AAGTGAAATA AAATTTCAAA TTACAACGTA  GTTTAATAAT ATAAGTCATA ACCGATACAA TAGTCACTAG AACATAAAAC TAATATATAT GTCCAACTTT ACAACGTATA CTCTTTTTTT GGAATTTTTG TTTTGTCCTA AATTGGTGTT  TCTTATATCT TGATGCCTAA TCTTTGTTTT GTAACATGCG CAATGATATT AAAACATTAT ATTATACTAG GGGAGGAGAA CAAATTAAAA TTTCACACAA CTACTCTATA GAACTGAATT  ATTCATAAAC GGACGAGAGC ATTTCAACTG CTCGAAATAT TTTCCTATCA TCAGGAGTGG CGTTTCGTCA GATTACCACG CCAATTTATT TCTTTAAGTC TGTCAAACGT TGGCATCTTC  TAATAAACTG ATATATATAT ATGTGGATTC TAAACAAACA AAAAAAAAAC TTGAGAGGAT ATTTTTAGAT TTTCATCCTG GAAAAATAAG TGAGGCTAGA GAAGATTTTG ATGAAAGAAA  TCTTTAAATT TTAAACTCTT TTGGAAATAT CTTGAAAAAG GATTTTCCCT GTAATTTATA AGCGGAAACA ATTCGGACCG GGGCCAAAAC ATGTTAGAAA TATGTGGATT TGCAGATTTC  TGTTCGGGTC GGCCGGTTCT GCCTAGTTGT CTAGTTGACT AAGGTTTTGT GGACGGGTTC GTTATTTTTC TAGCGACTAA GTAAACATGC CCTCTTCCAT GACCTGGCGT CTAGAAGAAT  AGTCACGGAA CGTGTGTTCC ACACTCGTTA TAGACCGTAT TCAACTATTC AATTTTTCCC AAAGAAATTA CTTAAGAATT TAATTAGCAA GTTGGGTCTT AGTAACTGAA AACAGATACA  TATTTCTAAT GTTATTTTAT GAGTTGTCGT TTGAACAATG TCCACTAAAT GATAACGTGC AAGACATTCG TGAATGTCTA ATGTGAAAAA TTCCGTTTTA TAAGGCGAAA TGACCATTAT  TTTATCTTAT AAACAATAGT CAATTGTGTT TCATAGGAAA TTTAATATAT TCAATTGAAA CACCAGCAGA GATCAAGAAG ATAGTGGAAG GCCATGCAAT GTCCTCCTCG AGCTCCTCTT  GTATTTCAAC CCTCATTAAG AAACAGAGGA AAAATGCAAA TGGGATTATC TAAATCTTGT TTGGCATTTC TCCATGGACT ATTTCAAAGC CGCTGGGTGA TCTATAAAAG GCCTGAGAAT 
GTCTCCTTCA TCTTCATCTC CAAAGCTCGT TCTCACCTTA CTTGGCAAAC ACTCAACGAA GAAAGGAGAG AGAGACGGTA 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTGGATCGA TCAGACCGGG TTTCGGATGA TTTTGAGTCT ACACGTTTTT CTCTGCTTAT TTTCTTTCTT TTTCTTTTTT CTTTCACGGA AGTTTGAGCT TTGGTGTTGT CTTCTTCTGT  TTCTTCCATG AATAATTGTT TTTTGTTGAG TAACTTTACA TTTGTATTCT TTACGGTGAC TGTGTTTTGT AATGGAAAAA GTTTGTTTCG AATTCATCCG TTAAACGTAA ACCTAAATTA  AACAAAAATT ATAATTGGAA AGCAAAACAT TTTGTAAGCT TCGTGGTGTT TTTACTATGA ATTAATATTT ATGTTTGTTT TTCACGGTTA AAAAATTTAT TTATGTTTTT ATGTCAAGGA  GTTTTCATTT TTATTGATAA TTTTAGGATC ATAGGTGGGA AACAAACACA TTGGACTTTG GCCTTACATA TGATAACATT GGACTTTGGC CTTACATATT AAATTTCGTA TGTTTTACTT  TGGCCTTAAC ATTGGCCTTA TCATAGGTGT GTTTTATTTT TGTTATTGAT GAATGTTAAG GCCGAAGTAA AACATACTAA AGTTAAGGCC ATCAATAACA AAAATATTAA TTCATAGTTA  AAACGGTTAA AGAAGAGAAA ATCACAGTCG AATCGGATTC GGATCTTCTC TGGACTATAT CCATCAAGAA AACAGAACTT TCATACAAGA CCTTACACCT TAGGCCCGGT AACAAAACAC  ACTTATTATA CGCTACTATG ATGTTCCTGA TGCAACGAAC TAGTTCAACA TTATTGTGTT GATTTGTTGT TCACTGTACT AGCTAATAAT ACGTGTACCA TTACTGTCGT TTACCTTTAT  TATGAGATTA AAATTTCTTT GATTGTTTGT TTATGTGGGG CTTCGTTGAT TTGTCGTATT CAAAATTGTG ACTGGATGTT GGTTAGATAT TGGAATCTAC TTGTGCGGTA TATGAGAAAA 
GACAAAATTC AAAAGGTGAA TGACTACGAT TGAGCATAT 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATCAAGAACATTCTCGCCCTTGTGGTTCTTCTTAGCGTGGTTGGAGTTTCTGTCGCCATTCCACAGTTGCTTGACCTCGACTACTACCGGTCTAAGTGTCCCAAGGCAGAGGAA
ATTGTTCGTGGTGTCACAGTACAATATGTTTCTCGCCAGAAAACCCTTGCCGCTAAACTTCTAAGGATGCATTTCCATGATTGTTTCGTCAGA
GTAAGCTTGGTTCACTTGTTCGAGACT
GTTAACCAAGGGATATGAAAAAACTAGCTAGTCCTAACACTCTTTTGTAATGATTCATGTAGGGATGTGATGGTTCCGTTCTTCTGAAATCTGCAAAGAATGATGCGGAAAGAGACGCTG
TCCCCAACCTGACCCTGAAAGGTTATGAAGTGGTGGATGCGGCCAAGACAGCGCTGGAGAGGAAGTGTCCTAATCTCATTTCTTGCGCTGATGTTCTTGCCTTGGTCGCCAGAGATGCCG
TGGCAGTG
GTAACATTCCATTTTCGCAATGGACTAGTGATTTTGTCATTCCAAAACTGAAGACTATAGTATGTATATAACTTATTAATTGTCTTTGAACAGATCGGGGGACCATGGTGGC
CGGTTCCATTGGGCCGCAGGGATGGACGCATCTCGAAATTGAACGATGCATTGCTAAATTTACCATCTCCTTTCGCCGACATAAAGACGCTGAAGAAGAACTTTGCCAACAAGGGTCTTA
ACGCTAAAGACCTTGTGGTTCTCTCAG
GTATGTCTGCAGCTGGCACCTTATGATGTGCAATTCTCAAAAGAGTTATCAATTTGAAAGCTGAACAAAAATGGTTTCTTGAGTAGGGGGTCA
CACCATTGGAATCTCTAGTTGCGCTCTCGTCAACAGTCGTCTCTACAACTTCACAGGAAAGGGCGATTCTGACCCATCCATGAACCCTAGCTACGTGAGGGAATTGAAGAGAAAGTGCCC
GCCTACAGATTTCAGAACCTCACTGAACATGGACCCAGGCAGTGCGTTGACATTCGACACTCACTACTTCAAGGTCGTGGCTCAGAAGAAAGGGCTCTTCACATCTGACTCTACGCTTCT
CGATGACATTGAGACCAAAAACTACGTTCAGACTCAGGCCATTCTCCCTCCTGTGTTTTCTTCTTTCAATAAAGATTTCTCCGATTCCATGGTCAAACTTGGTTTCGTCCAAATTCTTAC
CGGCAAAAATGGTGAGATCAGGAAGAGATGCGCCTTCCCTAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATCAAGAACATTCTCGCCCTTGTGGTTCTTCTTAGCGTGGTTGGAGTTTCTGTCGCCATTCCACAGTTGCTTGACCTCGACTACTACCGGTCTAAGTGTCCCAAGGCAGAGGAA
ATTGTTCGTGGTGTCACAGTACAATATGTTTCTCGCCAGAAAACCCTTGCCGCTAAACTTCTAAGGATGCATTTCCATGATTGTTTCGTCAGA
GGATGTGATGGTTCCGTTCTTCTGAAA
TCTGCAAAGAATGATGCGGAAAGAGACGCTGTCCCCAACCTGACCCTGAAAGGTTATGAAGTGGTGGATGCGGCCAAGACAGCGCTGGAGAGGAAGTGTCCTAATCTCATTTCTTGCGCT
GATGTTCTTGCCTTGGTCGCCAGAGATGCCGTGGCAGTG
ATCGGGGGACCATGGTGGCCGGTTCCATTGGGCCGCAGGGATGGACGCATCTCGAAATTGAACGATGCATTGCTAAATTTA
CCATCTCCTTTCGCCGACATAAAGACGCTGAAGAAGAACTTTGCCAACAAGGGTCTTAACGCTAAAGACCTTGTGGTTCTCTCAG
GGGGTCACACCATTGGAATCTCTAGTTGCGCTCTC
GTCAACAGTCGTCTCTACAACTTCACAGGAAAGGGCGATTCTGACCCATCCATGAACCCTAGCTACGTGAGGGAATTGAAGAGAAAGTGCCCGCCTACAGATTTCAGAACCTCACTGAAC
ATGGACCCAGGCAGTGCGTTGACATTCGACACTCACTACTTCAAGGTCGTGGCTCAGAAGAAAGGGCTCTTCACATCTGACTCTACGCTTCTCGATGACATTGAGACCAAAAACTACGTT
CAGACTCAGGCCATTCTCCCTCCTGTGTTTTCTTCTTTCAATAAAGATTTCTCCGATTCCATGGTCAAACTTGGTTTCGTCCAAATTCTTACCGGCAAAAATGGTGAGATCAGGAAGAGA
TGCGCCTTCCCTAACTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCTCCAAAGC TCGTTCTCAC CTTACTTGGC AAACACTCAA CGAAGAAAGG AGAGAGAGAC GGTAATGGCG ATCAAGAACA TTCTCGCCCT TGTGGTTCTT CTTAGCGTGG TTGGAGTTTC  TGTCGCCATT CCACAGTTGC TTGACCTCGA CTACTACCGG TCTAAGTGTC CCAAGGCAGA GGAAATTGTT CGTGGTGTCA CAGTACAATA TGTTTCTCGC CAGAAAACCC TTGCCGCTAA  ACTTCTAAGG ATGCATTTCC ATGATTGTTT CGTCAGAGGA TGTGATGGTT CCGTTCTTCT GAAATCTGCA AAGAATGATG CGGAAAGAGA CGCTGTCCCC AACCTGACCC TGAAAGGTTA  TGAAGTGGTG GATGCGGCCA AGACAGCGCT GGAGAGGAAG TGTCCTAATC TCATTTCTTG CGCTGATGTT CTTGCCTTGG TCGCCAGAGA TGCCGTGGCA GTGATCGGGG GACCATGGTG  GCCGGTTCCA TTGGGCCGCA GGGATGGACG CATCTCGAAA TTGAACGATG CATTGCTAAA TTTACCATCT CCTTTCGCCG ACATAAAGAC GCTGAAGAAG AACTTTGCCA ACAAGGGTCT  TAACGCTAAA GACCTTGTGG TTCTCTCAGG GGGTCACACC ATTGGAATCT CTAGTTGCGC TCTCGTCAAC AGTCGTCTCT ACAACTTCAC AGGAAAGGGC GATTCTGACC CATCCATGAA  CCCTAGCTAC GTGAGGGAAT TGAAGAGAAA GTGCCCGCCT ACAGATTTCA GAACCTCACT GAACATGGAC CCAGGCAGTG CGTTGACATT CGACACTCAC TACTTCAAGG TCGTGGCTCA  GAAGAAAGGG CTCTTCACAT CTGACTCTAC GCTTCTCGAT GACATTGAGA CCAAAAACTA CGTTCAGACT CAGGCCATTC TCCCTCCTGT GTTTTCTTCT TTCAATAAAG ATTTCTCCGA  TTCCATGGTC AAACTTGGTT TCGTCCAAAT TCTTACCGGC AAAAATGGTG AGATCAGGAA GAGATGCGCC TTCCCTAACT AATTTGGATC GATCAGACCG GGTTTCGGAT GATTTTGAGT  CTACACGTTT TTCTCTGCTT ATTTTCTTTC TTTTTCTTTT TTCTTTCACG GAAGTTTGAG CTTTGGTGTT GTCTTCTTCT GTTTCTTCCA TGAATAATTG TTTTTTGTTG AGTAACTTTA  CATTTGTATT CTTTACGGTG ACTGTGTTTT GTAATGGAAA AAGTTTGTTT CGAATTCATC CGTTAAACGT AAACCTAAAT TAAACAAAAA TTATAATTGG AAAGCAAAAC ATTTTGTAAG 
CTTCGTGGTG TTTTTACTAT GAATTAATAT TTATGTTTGT TTTTC 

Retrieve as FASTA