Entry information : BdiPrx26 (Bradi1g38350)
Entry ID 7807
Creation 2011-01-05 (Christophe Dunand)
Last sequence changes 2011-01-05 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx26 (Bradi1g38350)
Name (synonym) BdiPrx26 (Bradi1g38350)
Class Class III peroxidase    [Orthogroup: Prx080]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx26
start..stop
S start..stop
BdiPrx27 449 2e-160 1..321 1..325
SiPrx40 441 3e-157 1..321 1..326
TaPrx28 430 8e-153 25..322 25..323
SiPrx28 412 9e-146 6..321 7..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 34631532..34631753 222 N° 2 34630693..34631439 747  
complement(join(34630693..34631439,34631532..34631753))


exon

Literature and cross-references BdiPrx26 (Bradi1g38350)
DNA ref. Phytozome 12:   Bd1 (34631753..34630693)
Protein sequence: BdiPrx26 (Bradi1g38350)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (299)
PWM (Da):   %s   34579.09 (32179.8) Transmb domain:   %s   i7-24o
PI (pH):   %s   6.65 (6.36) Peptide Signal:   %s   cut: 24 range:24-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAYSKSSCVVALALLLFVALAFTANGAKLSARYYDKTCPNVQRVVRSVMARNVAGQPGIAPAVLRLFFHDCFVNGCDGSVLLDSTPFWDSEKDAVPNASLRGFEVVEQIKSLLEHDCPATVSCADILALASRDAVAMLGGPAWNVPLGRKDSRAAHKDAAEAGLPSPQDNLTALVSAFRERGLDARDMTALSGAHTVGMASCENYRERVHGDGDIDPSFAETRRRNCPPSGNDGGMAPFDEQTPMRFDNAYYKDLIARRGLLSSDQALYGSGGKQDGLVEMYSRDGETFARDFAKAMVRMGNIRPPKGTPVEVRLSCNVVNN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATACTCCAAGAGCTCTTGCGTCGTTGCACTTGCCTTGCTCCTCTTCGTTGCGCTGGCTTTCACCGCAAATGGCGCCAAGCTCTCGGCCAGGTACTACGACAAGACGTGCCCGAAC
GTGCAGCGCGTTGTGCGGTCCGTGATGGCGCGCAACGTCGCCGGCCAGCCGGGGATCGCCCCCGCCGTCCTCCGCCTCTTCTTCCATGACTGTTTCGTCAAC
GTACGTACACTCATCATC
TAGCCTTGTTCATCAACAAACAAACCCTTGATCCTAAATTCCTAATTGCTTAATTACAATGTGCAAATGTGCAGGGATGCGATGGCTCCGTTCTCCTGGATAGCACGCCCTTCTGGGACA
GCGAGAAGGACGCGGTGCCCAACGCGTCGCTCCGGGGCTTCGAGGTGGTGGAGCAGATCAAGTCCCTGCTGGAGCACGACTGCCCGGCCACCGTGTCCTGCGCCGACATACTCGCCCTCG
CCTCCCGCGACGCCGTGGCCATGCTCGGTGGCCCGGCCTGGAACGTGCCCCTGGGCCGCAAGGACTCGCGCGCGGCCCACAAGGATGCCGCCGAGGCCGGTCTCCCCAGCCCGCAGGACA
ACCTCACGGCGCTCGTCTCCGCGTTCAGGGAGCGCGGCCTGGACGCCCGCGACATGACCGCGCTCTCCGGCGCGCACACTGTCGGCATGGCCAGCTGCGAGAACTACAGGGAGCGTGTGC
ACGGCGACGGCGACATCGACCCCTCCTTCGCCGAGACCAGGCGGCGGAACTGCCCGCCGTCCGGCAATGACGGTGGCATGGCGCCATTCGACGAGCAGACGCCCATGAGGTTCGACAATG
CCTACTACAAGGACCTGATCGCGCGGCGTGGGCTCCTTAGCTCCGACCAGGCGCTCTACGGCTCCGGTGGGAAGCAGGACGGTCTGGTGGAGATGTATAGCAGGGATGGGGAGACCTTCG
CGAGGGACTTCGCCAAGGCCATGGTGAGGATGGGGAACATACGCCCGCCCAAGGGGACGCCGGTGGAGGTCAGGCTCAGTTGCAACGTGGTCAACAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATACTCCAAGAGCTCTTGCGTCGTTGCACTTGCCTTGCTCCTCTTCGTTGCGCTGGCTTTCACCGCAAATGGCGCCAAGCTCTCGGCCAGGTACTACGACAAGACGTGCCCGAAC
GTGCAGCGCGTTGTGCGGTCCGTGATGGCGCGCAACGTCGCCGGCCAGCCGGGGATCGCCCCCGCCGTCCTCCGCCTCTTCTTCCATGACTGTTTCGTCAAC
GGATGCGATGGCTCCGTT
CTCCTGGATAGCACGCCCTTCTGGGACAGCGAGAAGGACGCGGTGCCCAACGCGTCGCTCCGGGGCTTCGAGGTGGTGGAGCAGATCAAGTCCCTGCTGGAGCACGACTGCCCGGCCACC
GTGTCCTGCGCCGACATACTCGCCCTCGCCTCCCGCGACGCCGTGGCCATGCTCGGTGGCCCGGCCTGGAACGTGCCCCTGGGCCGCAAGGACTCGCGCGCGGCCCACAAGGATGCCGCC
GAGGCCGGTCTCCCCAGCCCGCAGGACAACCTCACGGCGCTCGTCTCCGCGTTCAGGGAGCGCGGCCTGGACGCCCGCGACATGACCGCGCTCTCCGGCGCGCACACTGTCGGCATGGCC
AGCTGCGAGAACTACAGGGAGCGTGTGCACGGCGACGGCGACATCGACCCCTCCTTCGCCGAGACCAGGCGGCGGAACTGCCCGCCGTCCGGCAATGACGGTGGCATGGCGCCATTCGAC
GAGCAGACGCCCATGAGGTTCGACAATGCCTACTACAAGGACCTGATCGCGCGGCGTGGGCTCCTTAGCTCCGACCAGGCGCTCTACGGCTCCGGTGGGAAGCAGGACGGTCTGGTGGAG
ATGTATAGCAGGGATGGGGAGACCTTCGCGAGGGACTTCGCCAAGGCCATGGTGAGGATGGGGAACATACGCCCGCCCAAGGGGACGCCGGTGGAGGTCAGGCTCAGTTGCAACGTGGTC
AACAATTGA

Retrieve as FASTA