Entry information : BdiPrx37 (Bradi1g59540)
Entry ID 7810
Creation 2011-01-06 (Toky Ramarohetra)
Last sequence changes 2011-01-06 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx37 (Bradi1g59540)
Name (synonym) BdiPrx37 (Bradi1g59540)
Class Class III peroxidase    [Orthogroup: Prx149]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx37
start..stop
S start..stop
SbPrx25 443 1e-157 18..330 30..344
SiPrx87 427 2e-151 27..330 37..339
ZmPrx21 425 2e-150 1..330 11..339
OsPrx94 418 1e-147 30..330 49..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 58563603..58564010 408 N° 2 58562912..58563496 585  
complement(join(58562912..58563496,58563603..58564010))


exon

Literature and cross-references BdiPrx37 (Bradi1g59540)
DNA ref. Phytozome 12:   Bd1 (58564010..58562912)
Protein sequence: BdiPrx37 (Bradi1g59540)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (311)
PWM (Da):   %s   34551.99 (32683.0)  
PI (pH):   %s   7.08 (7.09) Peptide Signal:   %s   cut: 20 range:20-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAAWLAALAFALAPLLCASEGNGTGIAFGYYNATCPEAETIVFRETARILRASPDLAASLLRLHYHDCFVQGCDASVLLDTTDAANPTEKDGKPNESLRGFDAVARVKDKLETACPATVSCADLLALMARDAVLLSKGPRWAVALGRRDGRSSSAGNCGELPPLYGNMTVMVEVFAGKGMDAKDIAVLSGAHTLGKAHCSSFADRLYSGANATCVTDPALDGRYAARLRLRCPGNNGGNGGAAAEMDAGSCGTFDTSYYRHVASKRGLLQSDAALMEHPVTAAYVRRAATGRYDGHFFSDFAESMAKMGAVGVLTGDQGEIRIKCNRVN*

Retrieve as FASTA  
Remarks Complete sequence (chromo 1, intron 2), no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCGGCATGGCTCGCCGCCTTGGCCTTCGCTTTGGCGCCGCTCCTGTGCGCCTCTGAGGGGAACGGGACCGGCATCGCGTTCGGGTACTACAACGCGACGTGCCCGGAGGCGGAG
ACGATCGTGTTCAGGGAGACGGCGCGGATCCTCCGGGCGTCGCCGGACCTGGCCGCGTCCCTGCTCCGGCTCCACTACCACGACTGCTTCGTCCAGGGCTGCGACGCCTCCGTGCTCCTC
GACACCACCGACGCCGCGAACCCCACGGAGAAGGACGGCAAGCCCAACGAGAGCCTCCGCGGCTTCGACGCCGTGGCGCGCGTCAAGGACAAGCTCGAGACGGCATGCCCCGCCACCGTA
TCCTGCGCCGACCTCCTCGCCCTCATGGCCCGCGACGCCGTCCTCCTG
GTACCCAATCTCTCCCGATTCACCTTCTAATTTCATCAATGGCGTCCGCCGATTGGAGCAAAAATCGGGATG
AATTTCAGTCCTCTGTTTTTGTGGGGCAAAATAGAGCAAGGGGCCGAGGTGGGCGGTGGCGCTGGGGCGGAGAGACGGCCGGAGCTCGAGCGCCGGCAACTGCGGCGAGCTTCCGCCGCT
GTACGGGAACATGACGGTAATGGTGGAGGTCTTCGCCGGGAAAGGGATGGACGCCAAGGACATCGCCGTGCTCTCCGGCGCGCACACGCTCGGCAAGGCGCACTGCTCCTCCTTCGCCGA
CCGGCTCTACTCCGGCGCAAACGCCACGTGCGTCACGGACCCGGCGCTCGACGGCAGGTACGCGGCCAGGCTGCGCTTGCGGTGCCCCGGCAACAATGGCGGCAATGGCGGCGCGGCGGC
GGAGATGGACGCCGGGAGCTGCGGGACGTTCGACACGAGCTACTACCGGCACGTGGCGAGCAAGCGCGGGCTGCTGCAGTCGGACGCCGCGCTCATGGAGCACCCGGTCACCGCCGCCTA
CGTCCGCCGCGCCGCGACCGGCAGGTATGACGGGCATTTCTTCAGCGACTTTGCGGAATCCATGGCCAAGATGGGCGCCGTCGGCGTGCTCACCGGCGACCAGGGAGAGATCAGGATCAA
GTGCAACCGTGTCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCGGCATGGCTCGCCGCCTTGGCCTTCGCTTTGGCGCCGCTCCTGTGCGCCTCTGAGGGGAACGGGACCGGCATCGCGTTCGGGTACTACAACGCGACGTGCCCGGAGGCGGAG
ACGATCGTGTTCAGGGAGACGGCGCGGATCCTCCGGGCGTCGCCGGACCTGGCCGCGTCCCTGCTCCGGCTCCACTACCACGACTGCTTCGTCCAGGGCTGCGACGCCTCCGTGCTCCTC
GACACCACCGACGCCGCGAACCCCACGGAGAAGGACGGCAAGCCCAACGAGAGCCTCCGCGGCTTCGACGCCGTGGCGCGCGTCAAGGACAAGCTCGAGACGGCATGCCCCGCCACCGTA
TCCTGCGCCGACCTCCTCGCCCTCATGGCCCGCGACGCCGTCCTCCTG
AGCAAGGGGCCGAGGTGGGCGGTGGCGCTGGGGCGGAGAGACGGCCGGAGCTCGAGCGCCGGCAACTGCGGC
GAGCTTCCGCCGCTGTACGGGAACATGACGGTAATGGTGGAGGTCTTCGCCGGGAAAGGGATGGACGCCAAGGACATCGCCGTGCTCTCCGGCGCGCACACGCTCGGCAAGGCGCACTGC
TCCTCCTTCGCCGACCGGCTCTACTCCGGCGCAAACGCCACGTGCGTCACGGACCCGGCGCTCGACGGCAGGTACGCGGCCAGGCTGCGCTTGCGGTGCCCCGGCAACAATGGCGGCAAT
GGCGGCGCGGCGGCGGAGATGGACGCCGGGAGCTGCGGGACGTTCGACACGAGCTACTACCGGCACGTGGCGAGCAAGCGCGGGCTGCTGCAGTCGGACGCCGCGCTCATGGAGCACCCG
GTCACCGCCGCCTACGTCCGCCGCGCCGCGACCGGCAGGTATGACGGGCATTTCTTCAGCGACTTTGCGGAATCCATGGCCAAGATGGGCGCCGTCGGCGTGCTCACCGGCGACCAGGGA
GAGATCAGGATCAAGTGCAACCGTGTCAACTGA

Retrieve as FASTA