Entry information : BdiPrx06 (Bradi1g17850)
Entry ID 7815
Creation 2011-01-06 (Toky Ramarohetra)
Last sequence changes 2011-01-06 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx06 (Bradi1g17850)
Name (synonym) BdiPrx06 (Bradi1g17850)
Class Class III peroxidase    [Orthogroup: Prx047]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx06
start..stop
S start..stop
TmPrx02 493 3e-178 2..312 4..316
TaPrx113-1B 490 1e-176 2..312 4..316
AvePrx113-1B 490 1e-176 2..312 4..316
HvPrx11 480 5e-173 11..312 9..315
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14466663..14466866 204 N° 2 14466263..14466439 177 N° 3 14465599..14466156 558  
complement(join(14465599..14466156,14466263..14466439,14466663..14466866))


exon

Literature and cross-references BdiPrx06 (Bradi1g17850)
DNA ref. Phytozome 12:   Bd1 (14466866..14465599)
Protein sequence: BdiPrx06 (Bradi1g17850)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   312 (289)
PWM (Da):   %s   32328.98 (30143.8)  
PI (pH):   %s   6.49 (6.49) Peptide Signal:   %s   cut: 24 range:24-312
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAASCISLQLMLVVAALAAVASAQLSPTFYDTSCPRAAATIKSAVAAAVASEPRMGASLLRLHFHDCFGCDASVLLSGNEQDTAPNKDSLRGYGVIDNIKTQVEALCNQTVSCADILTLAARDSVVALGGPSWTVPLGRRDSIDANAAATLTDLPGPDSSRSQLEAAFLKKNLSTADMVALSGAHTLGQAQCQNFRTRIYGGDTNINAAYATSLKASCPQTGTGTSLAPLDPTTPNGFDNAYYANLMNQRGLLHSDQALFNNDTTDNAVRNFASSAAAFSSAFASAMVKMGNIEPKTGTQGQIRIVCSKVNS*

Retrieve as FASTA  
Remarks Complete sequence from genome (Chromo 1, intron 1 and 2), no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCTCTTGCATTTCCTTGCAGCTGATGCTCGTGGTGGCAGCACTGGCCGCCGTAGCGTCGGCTCAGCTGTCGCCGACGTTCTACGACACGTCGTGCCCGAGGGCTGCTGCCACC
ATCAAGAGCGCCGTGGCGGCCGCCGTGGCCAGCGAGCCCCGCATGGGCGCGTCCCTGCTCCGCCTCCACTTCCACGACTGTTTC
GTCCAAGCAAGTTTCCACTAAATTTCCACTTAATTA
ACCGGCATTTTGTACTTACTGGTTATCTCAAGGCATTAGCTTTTAAACACTACTACATATAGACAGGATTACATACAAAATTGCAAATGCAAGTATCGCATGTTAACTAACTTGGTTGAT
AGAAAGAAAAAAAAAGAGGCAACCGGGGTTAACCATATATATGTGGATATTGCTTGCTTGGCTGCAGGGCTGCGACGCGTCCGTTCTGCTGTCGGGCAACGAGCAGGACACAGCTCCGAA
CAAGGATTCGCTTCGAGGCTACGGCGTCATCGACAACATCAAGACCCAGGTGGAGGCGCTCTGCAACCAGACCGTCTCCTGCGCCGACATCCTCACCCTCGCCGCTCGGGACTCGGTCGT
CGCC
GTAAGATCATCTTCCATACTATATATCATTTACATGGTCAAATATTAATTCTATCAGTTGACACGCTTGTAACAATAATCCAATTTCCTTCTTGGTTAATTTGCAGCTGGGAGGGC
CGTCGTGGACGGTTCCACTGGGCAGAAGGGACTCCATCGACGCGAACGCGGCGGCGACGCTCACCGACCTCCCGGGCCCGGACTCCAGCCGCTCGCAGCTCGAGGCGGCCTTCCTTAAGA
AGAACCTCAGCACGGCCGACATGGTGGCGCTCTCCGGCGCGCACACGCTGGGGCAGGCCCAGTGCCAGAACTTCAGGACACGGATCTACGGCGGCGACACCAACATCAACGCGGCCTACG
CCACGTCGCTCAAGGCCAGCTGCCCGCAGACAGGCACGGGCACCAGCCTGGCGCCGCTGGACCCGACCACCCCCAACGGCTTCGACAACGCCTACTACGCCAACCTCATGAACCAGAGGG
GCCTCCTGCACTCGGACCAGGCGCTCTTTAACAATGACACGACGGACAACGCGGTCCGGAACTTCGCGTCCAGCGCGGCGGCCTTCAGCAGCGCCTTTGCTTCCGCCATGGTGAAGATGG
GGAATATCGAGCCCAAGACCGGGACGCAGGGGCAGATCAGGATCGTCTGCTCCAAGGTTAACTCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCTCTTGCATTTCCTTGCAGCTGATGCTCGTGGTGGCAGCACTGGCCGCCGTAGCGTCGGCTCAGCTGTCGCCGACGTTCTACGACACGTCGTGCCCGAGGGCTGCTGCCACC
ATCAAGAGCGCCGTGGCGGCCGCCGTGGCCAGCGAGCCCCGCATGGGCGCGTCCCTGCTCCGCCTCCACTTCCACGACTGTTTC
GGCTGCGACGCGTCCGTTCTGCTGTCGGGCAACGAG
CAGGACACAGCTCCGAACAAGGATTCGCTTCGAGGCTACGGCGTCATCGACAACATCAAGACCCAGGTGGAGGCGCTCTGCAACCAGACCGTCTCCTGCGCCGACATCCTCACCCTCGCC
GCTCGGGACTCGGTCGTCGCC
CTGGGAGGGCCGTCGTGGACGGTTCCACTGGGCAGAAGGGACTCCATCGACGCGAACGCGGCGGCGACGCTCACCGACCTCCCGGGCCCGGACTCCAGC
CGCTCGCAGCTCGAGGCGGCCTTCCTTAAGAAGAACCTCAGCACGGCCGACATGGTGGCGCTCTCCGGCGCGCACACGCTGGGGCAGGCCCAGTGCCAGAACTTCAGGACACGGATCTAC
GGCGGCGACACCAACATCAACGCGGCCTACGCCACGTCGCTCAAGGCCAGCTGCCCGCAGACAGGCACGGGCACCAGCCTGGCGCCGCTGGACCCGACCACCCCCAACGGCTTCGACAAC
GCCTACTACGCCAACCTCATGAACCAGAGGGGCCTCCTGCACTCGGACCAGGCGCTCTTTAACAATGACACGACGGACAACGCGGTCCGGAACTTCGCGTCCAGCGCGGCGGCCTTCAGC
AGCGCCTTTGCTTCCGCCATGGTGAAGATGGGGAATATCGAGCCCAAGACCGGGACGCAGGGGCAGATCAGGATCGTCTGCTCCAAGGTTAACTCGTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCGCCT CTTGCATTTC CTTGCAGCTG ATGCTCGTGG TGGCAGCACT GGCCGCCGTA GCGTCGGCTC AGCTGTCGCC GACGTTCTAC GACACGTCGT GCCCGAGGGC TGCTGCCACC  ATCAAGAGCG CCGTGGCGGC CGCCGTGGCC AGCGAGCCCC GCATGGGCGC GTCCCTGCTC CGCCTCCACT TCCACGACTG TTTCGGCTGC GACGCGTCCG TTCTGCTGTC GGGCAACGAG  CAGGACACAG CTCCGAACAA GGATTCGCTT CGAGGCTACG GCGTCATCGA CAACATCAAG ACCCAGGTGG AGGCGCTCTG CAACCAGACC GTCTCCTGCG CCGACATCCT CACCCTCGCC  GCTCGGGACT CGGTCGTCGC CCTGGGAGGG CCGTCGTGGA CGGTTCCACT GGGCAGAAGG GACTCCATCG ACGCGAACGC GGCGGCGACG CTCACCGACC TCCCGGGCCC GGACTCCAGC  CGCTCGCAGC TCGAGGCGGC CTTCCTTAAG AAGAACCTCA GCACGGCCGA CATGGTGGCG CTCTCCGGCG CGCACACGCT GGGGCAGGCC CAGTGCCAGA ACTTCAGGAC ACGGATCTAC  GGCGGCGACA CCAACATCAA CGCGGCCTAC GCCACGTCGC TCAAGGCCAG CTGCCCGCAG ACAGGCACGG GCACCAGCCT GGCGCCGCTG GACCCGACCA CCCCCAACGG CTTCGACAAC  GCCTACTACG CCAACCTCAT GAACCAGAGG GGCCTCCTGC ACTCGGACCA GGCGCTCTTT AACAATGACA CGACGGACAA CGCGGTCCGG AACTTCGCGT CCAGCGCGGC GGCCTTCAGC  AGCGCCTTTG CTTCCGCCAT GGTGAAGATG GGGAATATCG AGCCCAAGAC CGGGACGCAG GGGCAGATCA GGATCGTCTG CTCCAAGGTT AACTCGTGAA TCAATCGTAC ATTCTTGAAT 
AGGATACTAA GAGGAAAGAT GATAGTATAG CGAGCTGCTG GCTATAACTT ATGTGAAGAA TAATGCCCGG GAAA 

Retrieve as FASTA