Entry information : BdiPrx07 (Bradi1g17860)
Entry ID 7816
Creation 2011-01-06 (Toky Ramarohetra)
Last sequence changes 2011-01-06 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx07 (Bradi1g17860)
Name (synonym) BdiPrx07 (Bradi1g17860)
Class Class III peroxidase    [Orthogroup: Prx009]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx07
start..stop
S start..stop
AvePrx111-1A_H938 507 0 1..320 1..316
TaPrx01-1B 503 0 1..320 1..316
HvPrx63 501 0 1..320 1..316
AvePrx111-1L_H938 501 0 1..320 1..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14469096..14469305 210 N° 2 14468713..14468904 192 N° 3 14468025..14468585 561  
complement(join(14468025..14468585,14468713..14468904,14469096..14469305))


exon

Literature and cross-references BdiPrx07 (Bradi1g17860)
Literature Vogel,J.P., Gu,Y.Q., Twigg,P., Lazo,G.R., Laudencia-Chingcuanco,D., Hayden,D.M., Donze,T.J., Vivian,L.A., Stamova,B. and Coleman-Derr,D.
EST sequencing and phylogenetic analysis of the model grass Brachypodium distachyon. Theor Appl Genet 113 (2), 186-195 (2006)
DNA ref. Phytozome 12:   Bd1 (14469305..14468025)
EST ref. GenBank:   DV485684.1 [5' end]   DV486554.1 [5' end]
Protein sequence: BdiPrx07 (Bradi1g17860)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (297)
PWM (Da):   %s   33215.41 (31077.4)  
PI (pH):   %s   6.49 (6.49) Peptide Signal:   %s   cut: 24 range:24-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASASCLMLLVAVAMAMASAASGQLSSTFYDTSCPKALDTIKTAVTAAVSSEARMGASLLRLHFHDCFVDGCDASVLLADTGSFVGEQTAAPNAGSIRGLNVIDNIKTQVEAVCKQTVSCADILAVAARDSVVTLGGPSWTVLLGRRDSTTASKTNAENDLPPPTFDLKNLTDNFANKQLSVTDMVALSGGHTIGQSQCLNFRDRIYNETNIDAAFAASLKSNCPRSTSSGNTSLAPLDVATPTAFDNKYFVNLQANKGLLHSDQVLFNGGGTDNTVRNFASNPAAFSAAFVTAMVNMGNIAPKTGSQGQIRLSCSKVNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1 and 2), 2 ESTs. Cultivar="Bd21".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTGCCTCTTGTCTTATGCTACTGGTGGCCGTGGCAATGGCAATGGCCTCGGCAGCGTCCGGGCAGCTGTCATCCACGTTCTACGACACGTCGTGTCCGAAGGCTCTGGACACC
ATCAAGACCGCCGTGACGGCCGCCGTCAGCAGCGAGGCCCGGATGGGCGCCTCGCTGCTCCGGCTCCACTTCCACGACTGCTTTGTCGAT
GTAAGTCCTTAGTCATAAGTTAATTTTTGT
TAATTGTCATACAATCCCGCTCTTACAAAATTCAGATCAATGTCATTGAAGGAATGCATGAACTGATCTGGCGAACAGAACAGAGAGATCACACTACAATTAAGCAGCTTAATGATCAGG
GTTTAATAATTCTGAACTTTGTGCTCCATGCATGCACGCAGGGATGTGACGCGTCAGTCCTGCTGGCCGACACGGGGAGCTTCGTGGGCGAGCAAACCGCAGCTCCGAACGCCGGCTCCA
TCCGGGGCCTCAACGTCATCGACAACATCAAGACCCAGGTGGAGGCCGTGTGCAAGCAGACCGTCTCCTGCGCCGACATCCTCGCCGTCGCCGCCCGCGACTCCGTCGTCACG
GTACGAT
AATTAAACCTCCAGTCCATCATCGTCGTCGTCGTCATCGTCGTCGTCGTCATCATCATTATCATTATCATCCAAAATCGTTAATCTGAACTTAATTTTGCGCATCCATGAATGAATTCAG

CTGGGAGGGCCATCATGGACAGTGCTCCTAGGCAGGAGAGACTCCACAACAGCAAGCAAGACCAACGCAGAGAACGACCTGCCACCCCCAACCTTCGACCTCAAGAACCTCACCGACAAC
TTCGCCAACAAGCAGCTCAGCGTGACCGACATGGTGGCGCTCTCAGGCGGCCACACCATCGGCCAATCGCAGTGCCTCAACTTCAGGGACAGGATCTACAACGAGACCAACATCGACGCC
GCCTTCGCGGCGTCCCTCAAGTCCAACTGCCCGCGTTCCACGAGCTCCGGCAACACAAGCCTGGCGCCGCTCGACGTCGCGACGCCCACGGCGTTCGACAACAAGTACTTCGTGAACTTG
CAGGCCAACAAGGGCCTGCTGCATTCCGACCAGGTGTTGTTCAACGGTGGGGGCACGGATAACACGGTCAGGAACTTCGCGTCGAACCCGGCGGCGTTCAGTGCCGCGTTTGTGACGGCC
ATGGTGAATATGGGGAACATTGCGCCTAAGACTGGGTCGCAAGGGCAGATCAGGCTCAGCTGCTCCAAGGTCAACTCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTGCCTCTTGTCTTATGCTACTGGTGGCCGTGGCAATGGCAATGGCCTCGGCAGCGTCCGGGCAGCTGTCATCCACGTTCTACGACACGTCGTGTCCGAAGGCTCTGGACACC
ATCAAGACCGCCGTGACGGCCGCCGTCAGCAGCGAGGCCCGGATGGGCGCCTCGCTGCTCCGGCTCCACTTCCACGACTGCTTTGTCGAT
GGATGTGACGCGTCAGTCCTGCTGGCCGAC
ACGGGGAGCTTCGTGGGCGAGCAAACCGCAGCTCCGAACGCCGGCTCCATCCGGGGCCTCAACGTCATCGACAACATCAAGACCCAGGTGGAGGCCGTGTGCAAGCAGACCGTCTCCTGC
GCCGACATCCTCGCCGTCGCCGCCCGCGACTCCGTCGTCACG
CTGGGAGGGCCATCATGGACAGTGCTCCTAGGCAGGAGAGACTCCACAACAGCAAGCAAGACCAACGCAGAGAACGAC
CTGCCACCCCCAACCTTCGACCTCAAGAACCTCACCGACAACTTCGCCAACAAGCAGCTCAGCGTGACCGACATGGTGGCGCTCTCAGGCGGCCACACCATCGGCCAATCGCAGTGCCTC
AACTTCAGGGACAGGATCTACAACGAGACCAACATCGACGCCGCCTTCGCGGCGTCCCTCAAGTCCAACTGCCCGCGTTCCACGAGCTCCGGCAACACAAGCCTGGCGCCGCTCGACGTC
GCGACGCCCACGGCGTTCGACAACAAGTACTTCGTGAACTTGCAGGCCAACAAGGGCCTGCTGCATTCCGACCAGGTGTTGTTCAACGGTGGGGGCACGGATAACACGGTCAGGAACTTC
GCGTCGAACCCGGCGGCGTTCAGTGCCGCGTTTGTGACGGCCATGGTGAATATGGGGAACATTGCGCCTAAGACTGGGTCGCAAGGGCAGATCAGGCTCAGCTGCTCCAAGGTCAACTCC
TGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCAGTGTTCA GCAAGAGCTA GCCACACGAT CAAACTAAAA ATAAGCGCCG AGGAACACTT TTGTTTTAAG GTTTAATTAG CATGGCTTCT GCCTCTTGTC TTATGCTACT GGTGGCCGTG  GCAATGGCAA TGGCCTCGGC AGCGTCCGGG CAGCTGTCAT CCACGTTCTA CGACACGTCG TGTCCGAAGG CTCTGGACAC CATCAAGACC GCCGTGACGG CCGCCGTCAG CAGCGAGGCC  CGGATGGGCG CCTCGCTGCT CCGGCTCCAC TTCCACGACT GCTTTGTCGA TGGATGTGAC GCGTCAGTCC TGCTGGCCGA CACGGGGAGC TTCGTGGGCG AGCAAACCGC AGCTCCGAAC  GCCGGCTCCA TCCGGGGCCT CAACGTCATC GACAACATCA AGACCCAGGT GGAGGCCGTG TGCAAGCAGA CCGTCTCCTG CGCCGACATC CTCGCCGTCG CCGCCCGCGA CTCCGTCGTC  ACGCTGGGAG GGCCATCATG GACAGTGCTC CTAGGCAGGA GAGACTCCAC AACAGCAAGC AAGACCAACG CAGAGAACGA CCTGCCACCC CCAACCTTCG ACCTCAAGAA CCTCACCGAC  AACTTCGCCA ACAAGCAGCT CAGCGTGACC GACATGGTGG CGCTCTCAGG CGGCCACACC ATCGGCCAAT CGCAGTGCCT CAACTTCAGG GACAGGATCT ACAACGAGAC CAACATCGAC  GCCGCCTTCG CGGCGTCCCT CAAGTCCAAC TGCCCGCGTT CCACGAGCTC CGGCAACACA AGCCTGGCGC CGCTCGACGT CGCGACGCCC ACGGCGTTCG ACAACAAGTA CTTCGTGAAC  TTGCAGGCCA ACAAGGGCCT GCTGCATTCC GACCAGGTGT TGTTCAACGG TGGGGGCACG GATAACACGG TCAGGAACTT CGCGTCGAAC CCGGCGGCGT TCAGTGCCGC GTTTGTGACG  GCCATGGTGA ATATGGGGAA CATTGCGCCT AAGACTGGGT CGCAAGGGCA GATCAGGCTC AGCTGCTCCA AGGTCAACTC CTGATTAAGT TGGAGGCCTT CTAGCTCGAT CGGCATGGCA  GCACTTGTAA ACGACGACGA ATAAGGCCTC CACAGCGTGG CCGTGTGTGT GTTTTTTGTG ATCGAGTCGT ACGTGTGACG AACAAATTCT CCCGTGCAAA AAGACGTGGA GGATTTATTT 
GCTACTTCCT CTTGATTCGG ATAAATATAT GTGCTTCAGG ATGCGTAAGG TATTGGCGTG G 

Retrieve as FASTA