Entry information : BdiPrx08 (Bradi1g17870)
Entry ID 7817
Creation 2011-01-06 (Toky Ramarohetra)
Last sequence changes 2011-01-06 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx08 (Bradi1g17870)
Name (synonym) BdiPrx08 (Bradi1g17870)
Class Class III peroxidase    [Orthogroup: Prx059]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx08
start..stop
S start..stop
TaPrx20-1A 493 1e-177 1..314 1..312
HvPrx29 487 9e-176 23..315 21..313
TaPrx20-1B 477 1e-171 19..315 17..313
AvePrx108 477 1e-171 19..315 17..313
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14472942..14473325 384 N° 2 14471614..14472177 564  
complement(join(14471614..14472177,14472942..14473325))


exon

Literature and cross-references BdiPrx08 (Bradi1g17870)
DNA ref. Phytozome 12:   Bd1 (14473325..14471614)
Protein sequence: BdiPrx08 (Bradi1g17870)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   315 (293)
PWM (Da):   %s   32789.52 (30672.4)  
PI (pH):   %s   7.28 (7.31) Peptide Signal:   %s   cut: 23 range:23-315
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSLLPSVMLLLCLAASASAQLSPTFYATSCPKALDTIKAAVTAAVKKENRMGASLLRLHFHDCFVQGCDASVLLSGNEQNALPNVGSLRGFEVIDSIKAQVEALCKQTVSCADILTLAARDSVVALGGPSWTVPLGRRDSLTANEALANSDLPPPFFDLVNLTKSFGDKGFSLTEMVALSGAHTIGQAQCLNFRDRLYNETTSIDAAFAASLKPNCPRPTGAPGDGNLAALDVSTPYYFDNKYYVNLQAKKGLLHSDQVLFNGGGADNIVSNFASSAAAFSGAFASAMVKMGNLGPLTGSQGQVRLSCSKVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1), no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCTTCATCTCTATTACCATCAGTCATGTTGCTCCTGTGTCTAGCGGCATCGGCGTCGGCGCAGCTTTCGCCGACTTTCTACGCCACGTCGTGCCCGAAGGCTCTGGACACCATC
AAGGCCGCCGTGACAGCCGCCGTGAAGAAGGAGAACCGCATGGGTGCCTCCCTGCTCCGGCTCCACTTCCACGACTGCTTCGTCCAGGGCTGCGACGCCTCCGTCCTGCTCTCCGGCAAC
GAGCAGAACGCGCTCCCCAACGTTGGCTCCCTCCGAGGCTTCGAGGTCATCGACAGCATCAAGGCCCAAGTCGAGGCCCTCTGCAAGCAGACCGTCTCCTGCGCCGACATCCTCACCCTC
GCCGCCCGGGACTCCGTCGTCGCC
GTAAATAAGCTCAAACACCTTACATGCATACTTAATGTTCCCTCCGTTTCTAAATGTTCCCTCCGTTTCTAAATTGTTGTCGTGGTTTTAATTCAA
ATTTGAACTAAAACCATGACAAAAAATAAATTAGGAACGTAGAGAGTACAATAGCTAGGAAGCACGGATACGTTGATACGTATCTGATACGCGATACAGGGATACCACGATACGTCAATT
TTTTTAAAACATAGATACGGGGATACGTTTCTATATATATGTTAAATAAAAAAATACAGAAAGTACAAATTTTTATATGAGAAGCAGTCAAAAATTTAACTCCATTGCAAGATTGTTGCC
CAGTTTCCTGCAGTGCTCGAGCTCAAGCTCCCAACTGAAGCTGATGCTCTTCTTGCTATGGCTGACCTGGGCAGAGAAGGAGAGAACTGGAGAAAGAAGTCATGAAATCAATCACCCATT
CCGCGTGAACAGAGAAGGGAGATGGGTAGGATAAATCGATGGCCGATGGGCTTCTTCTGATGTTTAGTTTCCCGTATCCCACAAGTATCGGGAAGTATCCCTCACGTATCGGATATTTAA
AAAAAAAAATTAGATCGAAAAATTATCCGATACGGGCAAAATATGTATCGGGGAGTATCCAGGCGTATCCATGCAGTATCCGATACGGATACGCCAGCTCAGAGTCGTATCCGTGTTTCG
TACTACAACAGTACATTGCTCCCAAGGAGATCATTAATAATCTTGTTTTTTGCTCTTCTGGTGCACAGTTGGGAGGGCCATCTTGGACGGTGCCGCTGGGCAGGCGAGACTCGCTGACGG
CAAACGAGGCATTGGCCAACAGCGACCTTCCGCCGCCGTTCTTCGACCTTGTCAACCTCACAAAGTCCTTCGGCGACAAAGGATTCTCGCTCACAGAAATGGTGGCACTTTCAGGCGCTC
ACACAATCGGGCAAGCTCAGTGCCTCAACTTCAGGGACAGGCTCTACAACGAGACCACGAGCATCGACGCCGCCTTCGCGGCGTCCCTGAAGCCCAACTGCCCGCGGCCCACGGGCGCCC
CCGGCGACGGCAACCTGGCTGCGCTGGACGTGAGCACGCCCTACTACTTCGACAACAAGTACTATGTGAATTTGCAGGCCAAGAAGGGGCTGCTGCACTCGGACCAGGTGCTGTTTAACG
GCGGGGGAGCTGATAACATTGTCAGCAACTTCGCGTCCAGCGCGGCGGCGTTCAGTGGCGCATTCGCGTCGGCGATGGTGAAGATGGGGAACCTTGGCCCGTTGACTGGGTCGCAGGGCC
AGGTCAGGCTCAGCTGCTCCAAGGTGAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCTTCATCTCTATTACCATCAGTCATGTTGCTCCTGTGTCTAGCGGCATCGGCGTCGGCGCAGCTTTCGCCGACTTTCTACGCCACGTCGTGCCCGAAGGCTCTGGACACCATC
AAGGCCGCCGTGACAGCCGCCGTGAAGAAGGAGAACCGCATGGGTGCCTCCCTGCTCCGGCTCCACTTCCACGACTGCTTCGTCCAGGGCTGCGACGCCTCCGTCCTGCTCTCCGGCAAC
GAGCAGAACGCGCTCCCCAACGTTGGCTCCCTCCGAGGCTTCGAGGTCATCGACAGCATCAAGGCCCAAGTCGAGGCCCTCTGCAAGCAGACCGTCTCCTGCGCCGACATCCTCACCCTC
GCCGCCCGGGACTCCGTCGTCGCC
TTGGGAGGGCCATCTTGGACGGTGCCGCTGGGCAGGCGAGACTCGCTGACGGCAAACGAGGCATTGGCCAACAGCGACCTTCCGCCGCCGTTCTTC
GACCTTGTCAACCTCACAAAGTCCTTCGGCGACAAAGGATTCTCGCTCACAGAAATGGTGGCACTTTCAGGCGCTCACACAATCGGGCAAGCTCAGTGCCTCAACTTCAGGGACAGGCTC
TACAACGAGACCACGAGCATCGACGCCGCCTTCGCGGCGTCCCTGAAGCCCAACTGCCCGCGGCCCACGGGCGCCCCCGGCGACGGCAACCTGGCTGCGCTGGACGTGAGCACGCCCTAC
TACTTCGACAACAAGTACTATGTGAATTTGCAGGCCAAGAAGGGGCTGCTGCACTCGGACCAGGTGCTGTTTAACGGCGGGGGAGCTGATAACATTGTCAGCAACTTCGCGTCCAGCGCG
GCGGCGTTCAGTGGCGCATTCGCGTCGGCGATGGTGAAGATGGGGAACCTTGGCCCGTTGACTGGGTCGCAGGGCCAGGTCAGGCTCAGCTGCTCCAAGGTGAACTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATAGGTCAAC CGATCAAATC AATCTTCACA AGAGTGCCTT AATTCTAGCT CGATCGATCA CCACAAGCTA AGCTTAATTA AGCTAGCTAT AGCAGCCATG GCCTCTTCAT CTCTATTACC  ATCAGTCATG TTGCTCCTGT GTCTAGCGGC ATCGGCGTCG GCGCAGCTTT CGCCGACTTT CTACGCCACG TCGTGCCCGA AGGCTCTGGA CACCATCAAG GCCGCCGTGA CAGCCGCCGT  GAAGAAGGAG AACCGCATGG GTGCCTCCCT GCTCCGGCTC CACTTCCACG ACTGCTTCGT CCAGGGCTGC GACGCCTCCG TCCTGCTCTC CGGCAACGAG CAGAACGCGC TCCCCAACGT  TGGCTCCCTC CGAGGCTTCG AGGTCATCGA CAGCATCAAG GCCCAAGTCG AGGCCCTCTG CAAGCAGACC GTCTCCTGCG CCGACATCCT CACCCTCGCC GCCCGGGACT CCGTCGTCGC  CTTGGGAGGG CCATCTTGGA CGGTGCCGCT GGGCAGGCGA GACTCGCTGA CGGCAAACGA GGCATTGGCC AACAGCGACC TTCCGCCGCC GTTCTTCGAC CTTGTCAACC TCACAAAGTC  CTTCGGCGAC AAAGGATTCT CGCTCACAGA AATGGTGGCA CTTTCAGGCG CTCACACAAT CGGGCAAGCT CAGTGCCTCA ACTTCAGGGA CAGGCTCTAC AACGAGACCA CGAGCATCGA  CGCCGCCTTC GCGGCGTCCC TGAAGCCCAA CTGCCCGCGG CCCACGGGCG CCCCCGGCGA CGGCAACCTG GCTGCGCTGG ACGTGAGCAC GCCCTACTAC TTCGACAACA AGTACTATGT  GAATTTGCAG GCCAAGAAGG GGCTGCTGCA CTCGGACCAG GTGCTGTTTA ACGGCGGGGG AGCTGATAAC ATTGTCAGCA ACTTCGCGTC CAGCGCGGCG GCGTTCAGTG GCGCATTCGC  GTCGGCGATG GTGAAGATGG GGAACCTTGG CCCGTTGACT GGGTCGCAGG GCCAGGTCAG GCTCAGCTGC TCCAAGGTGA ACTAGGTTGA ATTTGAATCC TCGCCGTTGT TTCAAGGGGA  TGAGTGAGTG AATCGATTAA TAAGGCTCGC TATATATGTG GCCATTATAT TCCTCAATCA TAGTATGTTT ACAAGATTGG GAAAACTGAG AAAGGTGCAT GTATGTACTG AAGATGGTGT  GTATGTGTAC GTATCACAAG GAAGGACCTC ATGCAAAGGC ATGGAGGATT CCACTATTAT ACATACGGAG TATGAGTTAC TTCTTGGCTA AAAATTAAAC GCTCTGTGTT TAGTGATGTA 
GTAATATTAA CGTGCTACCT ATGTATCCAA TGTGGACCGA GCAATGCTAG GACGGCTTGA GTGTGCGTCC GCATGAGGTT GGTTGCTTCT CCTT 

Retrieve as FASTA