Entry information : BdiPrx09(Bradi1g17877 (3.1) / Bradi1g17880)
Entry ID 7818
Creation 2011-01-07 (Toky Ramarohetra)
Last sequence changes 2011-01-07 (Toky Ramarohetra)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2020-05-29 (Christophe Dunand)
Peroxidase information: BdiPrx09(Bradi1g17877 (3.1) / Bradi1g17880)
Name (synonym) BdiPrx09(Bradi1g17877 (3.1) / Bradi1g17880)
Class Class III peroxidase    [Orthogroup: Prx080]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx09
start..stop
S start..stop
AvePrx114-1B 481 4e-173 27..320 30..321
AvePrx114-1C 478 1e-171 26..320 29..321
TaPrx114-1A 466 3e-167 20..320 21..319
AvePrx114-1A 466 3e-167 20..320 21..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14477729..14477935 207 N° 2 14477080..14477271 192 N° 3 14476411..14476974 564  
complement(join(14476411..14476974,14477080..14477271,14477729..14477935))


exon

Literature and cross-references BdiPrx09(Bradi1g17877 (3.1) / Bradi1g17880)
DNA ref. Phytozome 12:   Bd1 (14477935..14476411)
Protein sequence: BdiPrx09(Bradi1g17877 (3.1) / Bradi1g17880)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (300)
PWM (Da):   %s   33363.03 (31390.0)  
PI (pH):   %s   8.49 (8.58) Peptide Signal:   %s   cut: 21 range:21-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASYVLPVLLLLCVAASASASPGLSPRFYARSCPGALDTIRIAVEEAVRNEPRMGASLLRLHFHDCFVQGCDASVLLNDTATFTGEQSAAPNVASIRGFAVIDNIKARVEAICRQTVSCADILALAARDSVVALGGPSWTVPLGRRDSTTASLSLANSDLPAPSFDVANLTAAFAAKNLSVTDMVALSGGHTIGDSQCLNFRDRIYNETNNIDAAFATSLKSICPRSTSSGNSSLAPLDVATPTAFDNKYYGNLLAKKGLLHSDQVLVNARGGVGGLVRRYAGSPARFGKDFGAAMVRMGNVSPLTGSQGQIRLICSRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1 and 2), no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCTTATGTGTTGCCAGTGTTGCTGCTCCTGTGTGTAGCGGCGTCGGCGTCAGCCTCGCCTGGGCTGTCGCCGAGGTTCTATGCGAGATCGTGTCCCGGAGCTCTGGACACCATC
AGGATCGCCGTGGAGGAGGCCGTGAGGAACGAGCCCCGCATGGGGGCCTCTCTGCTCCGGCTGCACTTCCACGACTGCTTCGTCCAA
GCAAGTCCCTGTCCATCATTATTTGCCATGCTT
AGTTACTTTTCTAGTACTAATACTCTTTTCTACTGCAGTTACTACTTGTTTACTCAATTTCGTTATCATTTTTCGACCAATTTAATCAAGCTGTGGTTAAATTTTAAAGTCACTATCTAA
AGTTGTTGGAATTGACACTACAAGTGTATTGTGTTTGTGTACCTAACCTAACTACTCAAAAGTTGACACCCGGAGACTCAAGTCCAAGGCCTTCTAATTTGACTCTTTAAAGTCTTCTTG
GCGCCAATTGCAACCAACCAAATCTGTTACTAGTATCACAGAAAAATTATTACTGCTCTCTGCATCTCTTGTGAAAAAAATATTACTCCTACTACTGTTTACATATTTTGTTTAACTACC
CAGTAGTAGCGGTTAATAATTGTGTGCTAATTAAGTGTGGAACTGGAAATGCATATCAAATCAGGGCTGCGACGCATCGGTGCTGCTGAATGACACGGCCACCTTCACCGGCGAGCAAAG
CGCTGCTCCCAACGTGGCGTCCATCCGAGGCTTCGCCGTCATCGACAACATCAAGGCCCGTGTCGAGGCCATCTGCCGGCAGACCGTCTCCTGCGCCGACATCCTTGCCCTCGCCGCCCG
CGACTCCGTCGTCGCC
GTAATTCCCCCCTCCTCCTCCTCCTCATCACCATTCTTGCACACTTGCACTACACAATCACTTCACTCAATATCAACACGTTTAATCACTTGCATTGCATTGCA
GCTGGGAGGCCCATCATGGACAGTCCCACTAGGCCGCCGGGACTCAACAACAGCAAGTCTCTCCCTAGCCAACAGCGACCTCCCAGCTCCATCCTTCGACGTGGCCAACCTGACAGCCGC
CTTCGCCGCCAAGAACCTCAGCGTGACCGACATGGTGGCCCTCTCAGGCGGCCACACAATCGGGGACTCGCAGTGCCTCAACTTCAGGGACAGGATCTACAACGAGACCAACAACATCGA
CGCCGCCTTCGCGACGTCGCTCAAATCCATCTGCCCGCGCTCCACGAGCTCCGGCAACAGCAGCCTGGCGCCTCTGGACGTAGCAACGCCCACAGCATTCGACAACAAGTACTATGGGAA
CTTGTTGGCGAAGAAGGGGCTCTTGCATTCGGACCAGGTGCTGGTGAATGCCAGAGGCGGCGTTGGCGGGCTTGTCAGGAGGTATGCGGGCTCCCCTGCGAGGTTTGGGAAGGATTTTGG
GGCTGCCATGGTGAGGATGGGGAATGTGAGCCCGCTCACTGGGTCGCAGGGCCAGATCAGGCTCATTTGTTCCAGGGTTAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCTTATGTGTTGCCAGTGTTGCTGCTCCTGTGTGTAGCGGCGTCGGCGTCAGCCTCGCCTGGGCTGTCGCCGAGGTTCTATGCGAGATCGTGTCCCGGAGCTCTGGACACCATC
AGGATCGCCGTGGAGGAGGCCGTGAGGAACGAGCCCCGCATGGGGGCCTCTCTGCTCCGGCTGCACTTCCACGACTGCTTCGTCCAA
GGCTGCGACGCATCGGTGCTGCTGAATGACACG
GCCACCTTCACCGGCGAGCAAAGCGCTGCTCCCAACGTGGCGTCCATCCGAGGCTTCGCCGTCATCGACAACATCAAGGCCCGTGTCGAGGCCATCTGCCGGCAGACCGTCTCCTGCGCC
GACATCCTTGCCCTCGCCGCCCGCGACTCCGTCGTCGCC
CTGGGAGGCCCATCATGGACAGTCCCACTAGGCCGCCGGGACTCAACAACAGCAAGTCTCTCCCTAGCCAACAGCGACCTC
CCAGCTCCATCCTTCGACGTGGCCAACCTGACAGCCGCCTTCGCCGCCAAGAACCTCAGCGTGACCGACATGGTGGCCCTCTCAGGCGGCCACACAATCGGGGACTCGCAGTGCCTCAAC
TTCAGGGACAGGATCTACAACGAGACCAACAACATCGACGCCGCCTTCGCGACGTCGCTCAAATCCATCTGCCCGCGCTCCACGAGCTCCGGCAACAGCAGCCTGGCGCCTCTGGACGTA
GCAACGCCCACAGCATTCGACAACAAGTACTATGGGAACTTGTTGGCGAAGAAGGGGCTCTTGCATTCGGACCAGGTGCTGGTGAATGCCAGAGGCGGCGTTGGCGGGCTTGTCAGGAGG
TATGCGGGCTCCCCTGCGAGGTTTGGGAAGGATTTTGGGGCTGCCATGGTGAGGATGGGGAATGTGAGCCCGCTCACTGGGTCGCAGGGCCAGATCAGGCTCATTTGTTCCAGGGTTAAC
TGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCTT ATGTGTTGCC AGTGTTGCTG CTCCTGTGTG TAGCGGCGTC GGCGTCAGCC TCGCCTGGGC TGTCGCCGAG GTTCTATGCG AGATCGTGTC CCGGAGCTCT GGACACCATC  AGGATCGCCG TGGAGGAGGC CGTGAGGAAC GAGCCCCGCA TGGGGGCCTC TCTGCTCCGG CTGCACTTCC ACGACTGCTT CGTCCAAGGC TGCGACGCAT CGGTGCTGCT GAATGACACG  GCCACCTTCA CCGGCGAGCA AAGCGCTGCT CCCAACGTGG CGTCCATCCG AGGCTTCGCC GTCATCGACA ACATCAAGGC CCGTGTCGAG GCCATCTGCC GGCAGACCGT CTCCTGCGCC  GACATCCTTG CCCTCGCCGC CCGCGACTCC GTCGTCGCCC TGGGAGGCCC ATCATGGACA GTCCCACTAG GCCGCCGGGA CTCAACAACA GCAAGTCTCT CCCTAGCCAA CAGCGACCTC  CCAGCTCCAT CCTTCGACGT GGCCAACCTG ACAGCCGCCT TCGCCGCCAA GAACCTCAGC GTGACCGACA TGGTGGCCCT CTCAGGCGGC CACACAATCG GGGACTCGCA GTGCCTCAAC  TTCAGGGACA GGATCTACAA CGAGACCAAC AACATCGACG CCGCCTTCGC GACGTCGCTC AAATCCATCT GCCCGCGCTC CACGAGCTCC GGCAACAGCA GCCTGGCGCC TCTGGACGTA  GCAACGCCCA CAGCATTCGA CAACAAGTAC TATGGGAACT TGTTGGCGAA GAAGGGGCTC TTGCATTCGG ACCAGGTGCT GGTGAATGCC AGAGGCGGCG TTGGCGGGCT TGTCAGGAGG  TATGCGGGCT CCCCTGCGAG GTTTGGGAAG GATTTTGGGG CTGCCATGGT GAGGATGGGG AATGTGAGCC CGCTCACTGG GTCGCAGGGC CAGATCAGGC TCATTTGTTC CAGGGTTAAC  TGATTCAGTT GTGGTACTGG CTGGTTAACT TTGTTCATGA ATGTAAGATG TTTTGATATG CTATTTTTAG CCTACCCAAA CGTCTTACAT TTTGCATGGA ATAAAGCTAG TATTAGCTAT 
AGCTACTGCT ATGTATCATG TACTGTGATG TATGAGAGCA TTCCGCTCAA AATTTGCCCA GATGTTCAAA TGCCATTCAA AAAAATTTGT TTCAAATTTG CCACTCAAA 

Retrieve as FASTA