Entry information : BdiPrx24 (Bradi1g38300)
Entry ID 7820
Creation 2011-01-07 (Toky Ramarohetra)
Last sequence changes 2011-01-07 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx24 (Bradi1g38300)
Name (synonym) BdiPrx24 (Bradi1g38300)
Class Class III peroxidase    [Orthogroup: Prx150]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx24
start..stop
S start..stop
OsPrx87 530 0 1..318 1..327
SbPrx137 523 0 23..318 23..318
ZmPrx76 510 0 1..318 1..318
OsPrx86 476 3e-171 25..318 31..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 34477710..34477922 213 N° 2 34478016..34478207 192 N° 3 34478298..34478849 552  
join(34477710..34477922,34478016..34478207,34478298..34478849)


exon

Literature and cross-references BdiPrx24 (Bradi1g38300)
DNA ref. Phytozome 12:   Bd1 (34477710..34478849)
Protein sequence: BdiPrx24 (Bradi1g38300)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (294)
PWM (Da):   %s   33228.7 (30773.4)  
PI (pH):   %s   8.75 (8.92) Peptide Signal:   %s   cut: 25 range:25-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGFLLARCIIGAATLLCVLPPCQAKFTSKFYGKTCPNLGAIVRSVMAPAVAKEPRMGASIIRLFFHDCFVNGCDGSILLDDTPTFTGEKNAGANVNSVRGYEVIDAIKTQVETACKATVSCADIIALASRDAVNLVGGPTWNVQLGRKDSRTASQSAANANLPGPGSSAASLVSAFAAKGLSAREMTALSGAHTVGRARCVLFRGRIYSDPNINATFAAARQQTCPQAGGDGNLAPFDDQTPDAFDNAYYKNLMAQRGLLHSDQELFNGGPQDALVRKYSGNAGIFAGDFAKAMVKMGGLMPVAGTPTEVRLNCRKVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1 and 2), no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCTTCTTGTTAGCTAGGTGCATTATCGGCGCTGCTACTCTCCTATGTGTGCTTCCTCCTTGTCAGGCCAAGTTCACAAGCAAGTTCTACGGCAAGACATGCCCAAATCTGGGAGCC
ATCGTGCGGTCGGTGATGGCGCCGGCCGTCGCCAAAGAGCCGCGGATGGGCGCATCGATCATCCGGCTCTTCTTCCATGACTGCTTCGTGAAC
GTGAGTCCATCGGTAGAATTTGCTCTT
GCCTGGCTTGCTAGCTTCCTGAGCTTACATACAGCGCCATCCGTATGTATGTTTGCAATTGCACAGGGATGTGACGGGTCGATCCTCCTGGACGACACGCCGACGTTCACCGGCGAGAAG
AACGCCGGCGCCAACGTCAACTCCGTCCGCGGGTACGAGGTGATCGACGCCATCAAGACACAGGTCGAAACGGCCTGCAAGGCCACGGTGTCCTGCGCCGACATCATCGCATTGGCATCT
CGCGACGCCGTAAACTTG
GTGAGTGCACGCTCGTCGGACCCGGTAAGAATGGTAATTAAAAGGACCTAAGCTTGCGACGTCTTACTGACGCGCCAATGTGCATAGCAGGTCGGTGGCCCG
ACGTGGAACGTGCAGCTGGGCAGGAAGGACTCGCGGACGGCGAGCCAGAGCGCGGCCAACGCCAACCTCCCGGGCCCAGGCTCCAGCGCCGCGTCGCTCGTCTCGGCGTTCGCGGCAAAG
GGGCTCTCCGCGCGGGAGATGACGGCGCTGTCCGGGGCGCACACTGTGGGGCGCGCGCGCTGCGTCCTCTTCCGCGGCCGCATCTACAGCGATCCCAACATCAACGCCACCTTCGCGGCG
GCGCGGCAGCAGACGTGCCCGCAGGCTGGCGGGGACGGCAACTTGGCGCCGTTCGACGACCAGACGCCTGACGCGTTCGACAACGCCTACTATAAGAACCTGATGGCGCAGCGCGGGCTG
CTGCACTCTGATCAGGAGCTCTTCAACGGCGGGCCGCAGGACGCGCTGGTGAGGAAGTACAGCGGCAATGCCGGCATCTTCGCCGGCGACTTCGCTAAGGCCATGGTCAAGATGGGTGGG
CTCATGCCGGTGGCCGGAACGCCGACGGAGGTCAGGCTGAATTGCAGGAAGGTGAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCTTCTTGTTAGCTAGGTGCATTATCGGCGCTGCTACTCTCCTATGTGTGCTTCCTCCTTGTCAGGCCAAGTTCACAAGCAAGTTCTACGGCAAGACATGCCCAAATCTGGGAGCC
ATCGTGCGGTCGGTGATGGCGCCGGCCGTCGCCAAAGAGCCGCGGATGGGCGCATCGATCATCCGGCTCTTCTTCCATGACTGCTTCGTGAAC
GGATGTGACGGGTCGATCCTCCTGGAC
GACACGCCGACGTTCACCGGCGAGAAGAACGCCGGCGCCAACGTCAACTCCGTCCGCGGGTACGAGGTGATCGACGCCATCAAGACACAGGTCGAAACGGCCTGCAAGGCCACGGTGTCC
TGCGCCGACATCATCGCATTGGCATCTCGCGACGCCGTAAACTTG
GTCGGTGGCCCGACGTGGAACGTGCAGCTGGGCAGGAAGGACTCGCGGACGGCGAGCCAGAGCGCGGCCAACGCC
AACCTCCCGGGCCCAGGCTCCAGCGCCGCGTCGCTCGTCTCGGCGTTCGCGGCAAAGGGGCTCTCCGCGCGGGAGATGACGGCGCTGTCCGGGGCGCACACTGTGGGGCGCGCGCGCTGC
GTCCTCTTCCGCGGCCGCATCTACAGCGATCCCAACATCAACGCCACCTTCGCGGCGGCGCGGCAGCAGACGTGCCCGCAGGCTGGCGGGGACGGCAACTTGGCGCCGTTCGACGACCAG
ACGCCTGACGCGTTCGACAACGCCTACTATAAGAACCTGATGGCGCAGCGCGGGCTGCTGCACTCTGATCAGGAGCTCTTCAACGGCGGGCCGCAGGACGCGCTGGTGAGGAAGTACAGC
GGCAATGCCGGCATCTTCGCCGGCGACTTCGCTAAGGCCATGGTCAAGATGGGTGGGCTCATGCCGGTGGCCGGAACGCCGACGGAGGTCAGGCTGAATTGCAGGAAGGTGAACTAA

Retrieve as FASTA