Entry information : BdiPrx28 (Bradi1g41020 / Bradi1g41115)
Entry ID 7822
Creation 2011-01-07 (Toky Ramarohetra)
Last sequence changes 2011-03-03 (Nizar Fawal)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx28 (Bradi1g41020 / Bradi1g41115)
Name (synonym) BdiPrx28 (Bradi1g41020 / Bradi1g41115)
Class Class III peroxidase    [Orthogroup: Prx110]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type Leaves
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx28
start..stop
S start..stop
ZmPrx48 449 7e-161 1..313 1..313
SbPrx134 449 1e-160 1..313 1..314
SbPrx135 446 2e-159 1..313 1..313
SiPrx37 433 2e-154 1..313 1..311
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 37539290..37539496 207 N° 2 37539618..37539797 180 N° 3 37539894..37540445 552  
join(37539290..37539496,37539618..37539797,37539894..37540445)


exon

Literature and cross-references BdiPrx28 (Bradi1g41020 / Bradi1g41115)
DNA ref. Phytozome 12:   Bd1 (37539290..37540445)
EST ref. GenBank:   GT856417.1 [3' end]   GT856418.1 [3' end]
Protein sequence: BdiPrx28 (Bradi1g41020 / Bradi1g41115)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   313 (291)
PWM (Da):   %s   33610.71 (31341.6)  
PI (pH):   %s   6.34 (5.76) Peptide Signal:   %s   cut: 23 range:23-313
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAPTFMHCLLAICLLSCAAHAQLSADFYADCCPSLESIVRTEMIKAISRERRIAAKLLRVFFHDCFVQGCDGSVLLDAPGEKTAIPNNNSLLGYEVIDTIKASVEAACPGVVSCADILALTARDGTFLLGGPSWSVPLGRRDSRGGNQSLANDNLPAPDSNLTVLIELFGRQGLSPAEMTTLSGAHTIGFSQCLNFRDRIYNDANISPSFAALRRQTCPRVGGNTTLAPIDVQTPGAFDTDYYQNLLTRRGLFRSDQALFNGGSQDALVRQYSFNPALFRRDFAAAMIKMGNICPLTGDDGEIRANCHVANS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1), 2 ESTs. Incorrect prediction from Phytozome (exon is missing). Strain="Bd21".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTCCTACCTTCATGCACTGCCTGCTCGCCATCTGTCTGCTCTCCTGTGCTGCCCACGCGCAGCTCTCGGCCGACTTCTACGCCGACTGCTGCCCCAGCTTGGAGTCCATCGTG
CGTACGGAGATGATCAAGGCCATCAGCCGCGAGCGGCGCATCGCAGCGAAGCTTCTCAGGGTCTTCTTCCACGACTGCTTCGTACAG
GTGATAATCCATTCTTCCACGACTGCTTCGTTC
ATGTGATAATCCATTCTTCCACGACTGCTTCAGGTGATTTGAGCGCGCGCGCGTGTCTAACTCTCGTACATGCATGCATGTTATGTAGGGGTGTGACGGGTCGGTTCTTCTGGACGCCCC
AGGTGAGAAAACTGCCATACCCAACAATAACTCCTTGCTGGGCTACGAAGTCATCGACACCATCAAGGCTAGCGTGGAGGCAGCGTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGC
GCTTACCGCCCGCGACGGAACGTTTCTG
GTACGTAGTACGTGCAAACTACTAAAACTTCACCGGCTCGATCAGTACGTTTATATAGGAGCTTAAATGCTTAATTTGCCTGATATATGGAT
GCAGCTGGGCGGACCAAGCTGGAGCGTGCCGCTGGGCCGGCGCGACTCGAGGGGCGGGAACCAGTCTCTGGCGAACGACAACCTCCCAGCGCCGGACTCCAACCTCACCGTGCTAATCGA
GCTCTTCGGCAGGCAGGGGCTCTCGCCAGCCGAGATGACGACGCTGTCCGGCGCGCACACCATTGGCTTCAGCCAGTGCCTCAACTTCCGGGACCGGATCTACAACGACGCCAACATCAG
CCCGTCCTTCGCCGCGCTGCGGCGGCAGACGTGCCCACGCGTGGGCGGCAACACCACCCTGGCGCCTATCGACGTGCAGACCCCGGGGGCGTTCGACACCGACTACTACCAGAACCTGCT
GACGAGACGCGGCCTGTTCCGCTCCGACCAGGCGCTCTTCAACGGCGGGTCGCAGGACGCGCTGGTGCGGCAGTACAGCTTCAACCCGGCCCTCTTCCGGAGGGACTTCGCGGCGGCCAT
GATAAAGATGGGCAACATATGCCCGCTCACCGGCGATGACGGTGAGATCAGGGCTAATTGCCACGTCGCCAACAGC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCTCCTACCTTCATGCACTGCCTGCTCGCCATCTGTCTGCTCTCCTGTGCTGCCCACGCGCAGCTCTCGGCCGACTTCTACGCCGACTGCTGCCCCAGCTTGGAGTCCATCGTG
CGTACGGAGATGATCAAGGCCATCAGCCGCGAGCGGCGCATCGCAGCGAAGCTTCTCAGGGTCTTCTTCCACGACTGCTTCGTACAG
GGGTGTGACGGGTCGGTTCTTCTGGACGCCCCA
GGTGAGAAAACTGCCATACCCAACAATAACTCCTTGCTGGGCTACGAAGTCATCGACACCATCAAGGCTAGCGTGGAGGCAGCGTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCG
CTTACCGCCCGCGACGGAACGTTTCTG
CTGGGCGGACCAAGCTGGAGCGTGCCGCTGGGCCGGCGCGACTCGAGGGGCGGGAACCAGTCTCTGGCGAACGACAACCTCCCAGCGCCGGAC
TCCAACCTCACCGTGCTAATCGAGCTCTTCGGCAGGCAGGGGCTCTCGCCAGCCGAGATGACGACGCTGTCCGGCGCGCACACCATTGGCTTCAGCCAGTGCCTCAACTTCCGGGACCGG
ATCTACAACGACGCCAACATCAGCCCGTCCTTCGCCGCGCTGCGGCGGCAGACGTGCCCACGCGTGGGCGGCAACACCACCCTGGCGCCTATCGACGTGCAGACCCCGGGGGCGTTCGAC
ACCGACTACTACCAGAACCTGCTGACGAGACGCGGCCTGTTCCGCTCCGACCAGGCGCTCTTCAACGGCGGGTCGCAGGACGCGCTGGTGCGGCAGTACAGCTTCAACCCGGCCCTCTTC
CGGAGGGACTTCGCGGCGGCCATGATAAAGATGGGCAACATATGCCCGCTCACCGGCGATGACGGTGAGATCAGGGCTAATTGCCACGTCGCCAACAGC

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTTCCAAAA CATTTTCTTT CATATACATA TAATTATAAT GTACTACACA AATTTACATT ATTGACAGAT ATAACGTCGT ATACAAACAT CATTGTACAC GAGAGATATT CAGACAAACC  AACGGCAGAG TACGTAATTT GAAACACAAT ACGGAGGATA TAGTAGGCCC ACCTGATGTC CCATATACTT CCATACCACG GCGATGTATA TATACTGTGC GTCACTTCTT GTGATGGCAC  CACTTATTCT ACTCACTGTC GCTGTTATAT GCGAGAGTTG ACATAAATAT CTACTTAGCA GTCGTCGATC GTACGGCTCA TATCATCTCG ATCAGCTAAT TACTAGCTGT TGGCGACGTG  GCAATTAGCC CTGATCTCAC CGTCATCGCC GGTGAGCGGG CATATGTTGC CCATCTTTAT CATGGCCGCC GCGAAGTCCC TCCGGAAGAG GGCCGGGTTG AAGCTGTACT GCCGCACCAG 
CGCGTCCTGC GACCCGCCGT TGAAGAGCGC CTGGTCGGAG CGGAACAGGC CGCGTCTCGT CAGCAGGTTC TGGTAGTAGT CGGTGTC 

Retrieve as FASTA