Entry information : BdiPrx56 (Bradi2g09690)
Entry ID 7824
Creation 2011-01-12 (Toky Ramarohetra)
Last sequence changes 2011-01-12 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx56 (Bradi2g09690)
Name (synonym) BdiPrx56 (Bradi2g09690)
Class Class III peroxidase    [Orthogroup: Prx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer Abiotic stress
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx56
start..stop
S start..stop
HvPrx38 644 0 1..334 1..333
BdiPrx55 634 0 1..334 1..337
SiPrx17 628 0 1..334 1..334
HvPrx01 627 0 1..334 1..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7960580..7960807 228 N° 2 7961409..7961600 192 N° 3 7961693..7962277 585  
join(7960580..7960807,7961409..7961600,7961693..7962277)


exon

Literature and cross-references BdiPrx56 (Bradi2g09690)
Literature Lucas,S., Rokhsar,D., Wang,M., Lindquist,E.A., Fox,S.E., Vogel,J., Bragg,J.N., McKenzie,N., Bevan,M.W., Garvin,D., Michael,T., Hazen,S., Chang,J., Laudencia-Chingcuanco,D., Weng,Y. and Mockler,T. DOE Joint Genome Institute Brachypodium distachyon EST project. Unpublished (2009)
DNA ref. Phytozome 12:   Bd2 (7960580..7962277)
EST ref. GenBank:   GT772405.1 [5' end]   GT772406.1 [3' end]
Protein sequence: BdiPrx56 (Bradi2g09690)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (309)
PWM (Da):   %s   35768.17 (33284.8) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.04 (7.99) Peptide Signal:   %s   cut: 26 range:26-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAISMGCLVVLCVVCPLLLAGAVRANPWYGLFPQFYDQSCPKAKEIVQSIVAQAVAQETRMAASLVRLHFHDCFVKGCDASVLLDNSSSIVSEKGSNPNLNSLRGFEVVDQIKVALEMACPGTVSCADILALAARDSTVLVGGPYWDVPLGRRDSLGASIQGSNNDLPAPNNTLPTIITKFKRLGLNIVDVVALSGGHTIGMSRCTSFRQRLYNQSGNGRADGTLDVSYAAQLRQGCPRSGGDNNLFPLDVVSPAKFDNLYFKNILAGKGLLSSDEVLLTKSAETAALVKAYADDVHLFFQHFAQSMVNMGNITPLTGSQGEIRKNCRRLNNYH*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, introns 1 and 2), 2 ESTs. Strain="Bd21".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATTTCCATGGGTTGCTTGGTGGTGCTCTGTGTTGTCTGTCCTCTCCTCCTTGCAGGTGCTGTCCGTGCCAATCCATGGTACGGCTTGTTCCCACAGTTCTACGACCAATCGTGC
CCAAAGGCAAAGGAGATTGTGCAATCCATCGTGGCACAGGCTGTTGCCCAAGAGACCAGGATGGCAGCATCCTTGGTCAGGCTGCATTTCCATGACTGCTTTGTCAAG
GTCTCTGCTTCC
TCTTTACTGCAGTATCCCTTACTTGTTTCTACAATGATATAATGATGCTTGCTGAACATAGTTCCTGTAATTTAGTACAGAAACATACATGCTTTAATGTTAGTGTATGAATAATACAAT
CAGCTAAACAATTTATTAGTTAAGTTCAGCAGTTTGAATCCTTAACGTGCAAAGTGTTCAGTTATAACTTAAGCTTTTGCTATAAATTTGTCCTTGCATTTGAAACCGTGTCCGGAGGAC
CAGAAAAGAATCTCTAGTTTTTAGGCTAACTTTTTAGTATTTACCAATGATAAGATAAGATAGCCTACCTACACAGCTACATTGCCCATGATGAGCACTACCTTATGTCTTCTTGACATG
ATCGAGTCTGTACGATGAATGCTTTTCCCCAACAAAAACAGATGGTGATTACTCAAATCAAATGCACAATAATTGGAGGTCTATGCAATGGTCGTCCTTCACTTAATGCATGTACCAATG
TACCTGATCAATCGACACTATTTTGTTGCATGTGCCCAATCTATGTACTACCCACATGCCTGATTTATCCACCAACATTTTCTGACATCTTTTCTTCTTGTGAGTATAGGGGTGTGATGC
ATCCGTGCTGCTGGACAATAGCAGCAGCATAGTCAGCGAGAAGGGTTCCAATCCCAATCTAAACTCCCTCCGGGGGTTCGAGGTCGTCGACCAAATCAAGGTCGCCCTTGAGATGGCCTG
CCCCGGCACCGTCTCCTGTGCTGACATCCTTGCCCTCGCCGCCCGTGACTCCACTGTCCTC
GTATGTGAACAACACAAGTAACTCTGTTCCTAGTTAGCAAGAACTAAACAATTCAGTAT
GTTTGATTTTTCGGGACCCAAATTGACCTACAGGTTGGTGGCCCATACTGGGACGTGCCACTCGGCCGGAGGGACTCTCTTGGCGCGAGCATCCAGGGCTCCAACAATGACCTCCCTGCC
CCCAACAATACCCTCCCCACCATCATCACCAAGTTCAAGCGCCTTGGCCTCAACATCGTGGATGTCGTCGCCCTCTCAGGTGGCCACACCATCGGCATGTCCCGATGCACCAGCTTTCGG
CAGAGGCTGTACAACCAGTCGGGCAACGGCAGGGCCGACGGCACACTGGATGTGTCCTACGCGGCACAACTGAGGCAGGGGTGCCCCCGCTCTGGCGGCGACAACAACCTCTTCCCACTG
GACGTCGTCAGCCCAGCCAAGTTTGACAACCTGTACTTCAAGAACATCCTGGCTGGCAAGGGCCTCCTCAGCTCTGACGAGGTCCTGCTCACCAAGAGCGCCGAGACAGCGGCGCTCGTC
AAGGCATACGCAGATGATGTGCACCTCTTCTTCCAGCACTTTGCACAGTCGATGGTGAACATGGGCAACATCACGCCACTGACTGGGTCACAGGGTGAGATCAGGAAGAACTGCAGGAGG
CTCAACAACTATCATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGATTTCCATGGGTTGCTTGGTGGTGCTCTGTGTTGTCTGTCCTCTCCTCCTTGCAGGTGCTGTCCGTGCCAATCCATGGTACGGCTTGTTCCCACAGTTCTACGACCAATCGTGC
CCAAAGGCAAAGGAGATTGTGCAATCCATCGTGGCACAGGCTGTTGCCCAAGAGACCAGGATGGCAGCATCCTTGGTCAGGCTGCATTTCCATGACTGCTTTGTCAAG
GGGTGTGATGCA
TCCGTGCTGCTGGACAATAGCAGCAGCATAGTCAGCGAGAAGGGTTCCAATCCCAATCTAAACTCCCTCCGGGGGTTCGAGGTCGTCGACCAAATCAAGGTCGCCCTTGAGATGGCCTGC
CCCGGCACCGTCTCCTGTGCTGACATCCTTGCCCTCGCCGCCCGTGACTCCACTGTCCTC
GTTGGTGGCCCATACTGGGACGTGCCACTCGGCCGGAGGGACTCTCTTGGCGCGAGCATC
CAGGGCTCCAACAATGACCTCCCTGCCCCCAACAATACCCTCCCCACCATCATCACCAAGTTCAAGCGCCTTGGCCTCAACATCGTGGATGTCGTCGCCCTCTCAGGTGGCCACACCATC
GGCATGTCCCGATGCACCAGCTTTCGGCAGAGGCTGTACAACCAGTCGGGCAACGGCAGGGCCGACGGCACACTGGATGTGTCCTACGCGGCACAACTGAGGCAGGGGTGCCCCCGCTCT
GGCGGCGACAACAACCTCTTCCCACTGGACGTCGTCAGCCCAGCCAAGTTTGACAACCTGTACTTCAAGAACATCCTGGCTGGCAAGGGCCTCCTCAGCTCTGACGAGGTCCTGCTCACC
AAGAGCGCCGAGACAGCGGCGCTCGTCAAGGCATACGCAGATGATGTGCACCTCTTCTTCCAGCACTTTGCACAGTCGATGGTGAACATGGGCAACATCACGCCACTGACTGGGTCACAG
GGTGAGATCAGGAAGAACTGCAGGAGGCTCAACAACTATCATTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACCCACAAGA AGAGAAGTAG AAGCAAACAA GTAGCAAGTT GGCAACTCTC TTATATCACT TGTAACGAAG TGCAGCAAAG GAATTACTTA CATGGCGATT TCCATGGGTT GCTTGGTGGT  GCTCTGTGTT GTCTGTCCTC TCCTCCTTGC AGGTGCTGTC CGTGCCAATC CATGGTACGG CTTGTTCCCA CAGTTCTACG ACCAATCGTG CCCAAAGGCA AAGGAGATTG TGCAATCCAT  CGTGGCACAG GCTGTTGCCC AAGAGACCAG GATGGCAGCA TCCTTGGTCA GGCTGCATTT CCATGACTGC TTTGTCAAGG GGTGTGATGC ATCCGTGCTG CTGGACAATA GCAGCAGCAT  AGTCAGCGAG AAGGGTTCCA ATCCCAATCT AAACTCCCTC CGGGGGTTCG AGGTCGTCGA CCAAATCAAG GTCGCCCTTG AGATGGCCTG CCCCGGCACC GTCTCCTGTG CTGACATCCT  TGCCCTCGCC GCCCGTGACT CCACTGTCCT CGTTGGTGGC CCATACTGGG ACGTGCCACT CGGCCGGAGG GACTCTCTTG GCGCGAGCAT CCAGGGCTCC AACAATGACC TCCCTGCCCC  CAACAATACC CTCCCCACCA TCATCACCAA GTTCAAGCGC CTTGGCCTCA ACATCGTGGA TGTCGTCGCC CTCTCAGGTG GCCACACCAT CGGCATGTCC CGATGCACCA GCTTTCGGCA  GAGGCTGTAC AACCAGTCGG GCAACGGCAG GGCCGACGGC ACACTGGATG TGTCCTACGC GGCACAACTG AGGCAGGGGT GCCCCCGCTC TGGCGGCGAC AACAACCTCT TCCCACTGGA  CGTCGTCAGC CCAGCCAAGT TTGACAACCT GTACTTCAAG AACATCCTGG CTGGCAAGGG CCTCCTCAGC TCTGACGAGG TCCTGCTCAC CAAGAGCGCC GAGACAGCGG CGCTCGTCAA  GGCATACGCA GATGATGTGC ACCTCTTCTT CCAGCACTTT GCACAGTCGA TGGTGAACAT GGGCAACATC ACGCCACTGA CTGGGTCACA GGGTGAGATC AGGAAGAACT GCAGGAGGCT  CAACAACTAT CATTGAATTA CTGAAGCTGC TGTGTGTGCT AAATTCTGTG TGGAGTTGGT GCCATATTTT GTTTGAATAA GCAAGTGTGG TTGTAATTTT CAAAATTACT CAATCATTTG 
TGTTATGTCA TTGCGAAATG TGTATGTAAT AATAATTCAA TATGTAAGAT GAGTCGTTAC TTTACTTGG 

Retrieve as FASTA