Entry information : BdiPrx72 (Bradi2g20840)
Entry ID 7826
Creation 2011-01-12 (Toky Ramarohetra)
Last sequence changes 2011-01-12 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx72 (Bradi2g20840)
Name (synonym) BdiPrx72 (Bradi2g20840)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx72
start..stop
S start..stop
BdiPrx73 593 0 19..327 18..326
BdiPrx71 577 0 19..327 18..323
TaPrx100 559 0 24..327 23..326
TaPrx24-1B 554 0 1..326 1..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 18275765..18275974 210 N° 2 18275465..18275650 186 N° 3 18274786..18275373 588  
complement(join(18274786..18275373,18275465..18275650,18275765..18275974))


exon

Literature and cross-references BdiPrx72 (Bradi2g20840)
DNA ref. Phytozome 12:   Bd2 (18275974..18274786)
EST ref. GenBank:   GT829009.1 [3' end]   GT829010.1 [3' end]
Protein sequence: BdiPrx72 (Bradi2g20840)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (304)
PWM (Da):   %s   35407.86 (33152.7)  
PI (pH):   %s   7.13 (6.62) Peptide Signal:   %s   cut: 24 range:24-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASRAAMMQALLLAALAVGSARAQLHEKFYSESCPSVEAIVRKELVSALSTTPNLAAALLRMHFHDCFVRGCDGSVLLDSANKTAEKDAVPNQTLRGFGFVDRVKAAVEKACPDTVSCADVLAILARDSVWLTKGPFWEVPLGRRDGSVSISNETDQLPPPTANFTVLTQLFAAKNLDAKDLVVLSAGHTIGISHCFSFTDRLFNFTGKVNPTDIDPTLDTEYMAKLRGKCRSLNDNTTVVEMDPGSFKTFDLDYFTVVAKRRGLFHSDGALLTNDFTRAYVQRHAGGAFKEEFFADFAASMVKMGNADVLTGSQGEIRKKCSVPNH*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2,intron 1 and 2), 2 ESTs. Strain="Bd21".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCAAGGGCTGCGATGATGCAGGCGCTGCTGCTGGCCGCGTTGGCGGTGGGGAGCGCGCGGGCGCAGCTGCACGAGAAGTTCTACAGCGAGTCGTGCCCCAGCGTGGAGGCCATC
GTCAGGAAGGAGCTGGTGAGCGCGCTCTCGACCACGCCTAACCTCGCCGCCGCGCTCCTCAGGATGCACTTCCATGACTGCTTCGTCAGG
GTAAGTTTACTAAGTACTCTGTCCAGTTTA
AGTTCTAAACCCAAAATATTTCAGAGGCCGTTCCCTGGCCCCTGGGCAGTCTCCTGATGTGAATGAACGAATGTATCAATGAAGGGGTGCGACGGGTCGGTTCTGCTGGACTCAGCGAAC
AAGACGGCGGAGAAGGACGCGGTGCCCAACCAGACGCTGCGCGGATTCGGCTTCGTCGACAGGGTGAAGGCCGCCGTGGAGAAGGCCTGCCCCGACACCGTCTCCTGCGCCGACGTGCTC
GCCATCTTGGCCAGAGACTCAGTCTGGCTG
GTGAGTGTTATCGTAGTACTAAGCAAAGTTGCAAATGACAATATGTACATGTATTGTATGTAGCTTAATGCTCTGCTCATGGTTCTATCA
GACCAAGGGCCCATTCTGGGAAGTTCCTCTCGGGCGGCGAGACGGCAGCGTGTCCATCTCCAACGAGACCGACCAGCTCCCACCCCCTACCGCCAACTTCACCGTGCTGACGCAGCTCTT
CGCCGCCAAGAACCTCGACGCCAAGGACCTCGTCGTCCTCTCGGCCGGCCACACCATCGGGATCTCGCATTGCTTCTCCTTCACCGACCGCCTCTTCAACTTCACCGGCAAGGTCAACCC
CACCGACATCGACCCCACGCTCGACACGGAGTACATGGCCAAGCTCAGGGGCAAGTGCAGGAGCCTCAACGACAACACCACCGTCGTCGAGATGGACCCCGGCAGCTTCAAGACCTTCGA
TCTCGACTACTTCACCGTCGTGGCCAAGCGGAGGGGACTCTTCCACTCCGACGGCGCGCTGCTCACCAACGACTTCACCCGCGCCTACGTGCAGCGCCACGCTGGTGGTGCCTTCAAGGA
GGAGTTCTTCGCCGACTTCGCCGCGTCCATGGTCAAGATGGGCAACGCCGACGTGCTCACCGGTAGCCAGGGCGAGATCAGGAAGAAGTGCTCCGTGCCTAATCATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCAAGGGCTGCGATGATGCAGGCGCTGCTGCTGGCCGCGTTGGCGGTGGGGAGCGCGCGGGCGCAGCTGCACGAGAAGTTCTACAGCGAGTCGTGCCCCAGCGTGGAGGCCATC
GTCAGGAAGGAGCTGGTGAGCGCGCTCTCGACCACGCCTAACCTCGCCGCCGCGCTCCTCAGGATGCACTTCCATGACTGCTTCGTCAGG
GGGTGCGACGGGTCGGTTCTGCTGGACTCA
GCGAACAAGACGGCGGAGAAGGACGCGGTGCCCAACCAGACGCTGCGCGGATTCGGCTTCGTCGACAGGGTGAAGGCCGCCGTGGAGAAGGCCTGCCCCGACACCGTCTCCTGCGCCGAC
GTGCTCGCCATCTTGGCCAGAGACTCAGTCTGGCTG
ACCAAGGGCCCATTCTGGGAAGTTCCTCTCGGGCGGCGAGACGGCAGCGTGTCCATCTCCAACGAGACCGACCAGCTCCCACCC
CCTACCGCCAACTTCACCGTGCTGACGCAGCTCTTCGCCGCCAAGAACCTCGACGCCAAGGACCTCGTCGTCCTCTCGGCCGGCCACACCATCGGGATCTCGCATTGCTTCTCCTTCACC
GACCGCCTCTTCAACTTCACCGGCAAGGTCAACCCCACCGACATCGACCCCACGCTCGACACGGAGTACATGGCCAAGCTCAGGGGCAAGTGCAGGAGCCTCAACGACAACACCACCGTC
GTCGAGATGGACCCCGGCAGCTTCAAGACCTTCGATCTCGACTACTTCACCGTCGTGGCCAAGCGGAGGGGACTCTTCCACTCCGACGGCGCGCTGCTCACCAACGACTTCACCCGCGCC
TACGTGCAGCGCCACGCTGGTGGTGCCTTCAAGGAGGAGTTCTTCGCCGACTTCGCCGCGTCCATGGTCAAGATGGGCAACGCCGACGTGCTCACCGGTAGCCAGGGCGAGATCAGGAAG
AAGTGCTCCGTGCCTAATCATTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCAGAAGCAG AAGCAGCAGC AGTCCAAAGC AACGTTAGCT TCTCCTGATT TGGTAGCTAA TCGAGCTTCT TGTCGTGGAA GATGGCGTCA AGGGCTGCGA TGATGCAGGC GCTGCTGCTG  GCCGCGTTGG CGGTGGGGAG CGCGCGGGCG CAGCTGCACG AGAAGTTCTA CAGCGAGTCG TGCCCCAGCG TGGAGGCCAT CGTCAGGAAG GAGCTGGTGA GCGCGCTCTC GACCACGCCT  AACCTCGCCG CCGCGCTCCT CAGGATGCAC TTCCATGACT GCTTCGTCAG GGGGTGCGAC GGGTCGGTTC TGCTGGACTC AGCGAACAAG ACGGCGGAGA AGGACGCGGT GCCCAACCAG  ACGCTGCGCG GATTCGGCTT CGTCGACAGG GTGAAGGCCG CCGTGGAGAA GGCCTGCCCC GACACCGTCT CCTGCGCCGA CGTGCTCGCC ATCTTGGCCA GAGACTCAGT CTGGCTGACC  AAGGGCCCAT TCTGGGAAGT TCCTCTCGGG CGGCGAGACG GCAGCGTGTC CATCTCCAAC GAGACCGACC AGCTCCCACC CCCTACCGCC AACTTCACCG TGCTGACGCA GCTCTTCGCC  GCCAAGAACC TCGACGCCAA GGACCTCGTC GTCCTCTCGG CCGGCCACAC CATCGGGATC TCGCATTGCT TCTCCTTCAC CGACCGCCTC TTCAACTTCA CCGGCAAGGT CAACCCCACC  GACATCGACC CCACGCTCGA CACGGAGTAC ATGGCCAAGC TCAGGGGCAA GTGCAGGAGC CTCAACGACA ACACCACCGT CGTCGAGATG GACCCCGGCA GCTTCAAGAC CTTCGATCTC  GACTACTTCA CCGTCGTGGC CAAGCGGAGG GGACTCTTCC ACTCCGACGG CGCGCTGCTC ACCAACGACT TCACCCGCGC CTACGTGCAG CGCCACGCTG GTGGTGCCTT CAAGGAGGAG  TTCTTCGCCG ACTTCGCCGC GTCCATGGTC AAGATGGGCA ACGCCGACGT GCTCACCGGT AGCCAGGGCG AGATCAGGAA GAAGTGCTCC GTGCCTAATC ATTAGTTTAC AGAGCAAGTA  TGGGCTGGCA AAAGGATCTT GATTTGTGAC CGTCTTTTTT TCCTGTAGAT TTACTGTAAA GTTTCAGTTT TTTTACTTCC TTACCCATCT CCCCACTCCC CACCCCAAAT TTTCTGTTTG 
TTCAATTGAT TGTTTTGTCA CAGTTATGTA AAGTTTCCAC CAAGAACTCT GGATCATATA ATATATTTTG TTTTCTTGTT GAAATATAAA ATTGCCGGAT CA 

Retrieve as FASTA