Entry information : BdiPrx01 (Bradi1g07780)
Entry ID 7827
Creation 2011-01-12 (Toky Ramarohetra)
Last sequence changes 2011-01-12 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx01 (Bradi1g07780)
Name (synonym) BdiPrx01 (Bradi1g07780)
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx01
start..stop
S start..stop
OsPrx51 555 0 1..324 1..323
SiPrx163 497 4e-179 27..325 26..324
SbPrx02 493 1e-177 1..325 1..326
ZmPrx74 485 1e-174 1..325 1..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5515031..5515243 213 N° 2 5514703..5514903 201 N° 3 5514379..5514544 166 N° 4 5513277..5513677 401
complement(join(5513277..5513677,5514379..5514544,5514703..5514903,5515031..5515 243))


exon

Literature and cross-references BdiPrx01 (Bradi1g07780)
DNA ref. Phytozome 11:   Bd1 (5515243..5513277)
EST ref. GenBank:   DV471270.1 [Fragment]   DV471487.1 [Fragment]
Protein sequence: BdiPrx01 (Bradi1g07780)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (302)
PWM (Da):   %s   33910.73 (31633.5)  
PI (pH):   %s   4.55 (4.39) Peptide Signal:   %s   cut: 25 range:25-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGAGIRLLAALLVLASAGTPRCAAQLRQNYYDAVCPGVESIVRDAVAKKVNDTPVAVGATVRLFFHDCFVQGCDASVIVVSSGNNTAEKDHSANLSLAGDGFDTVIKAKAAVDAVPQCTNQVSCADILTMATRDVIALAGGPAYAVELGRLDGLSSLASNVDGNLPPPSFDLDQLNAMFTANNLSQTDMIALSAAHTVGFAHCGTFAGRIQTASQDPTMDSGYASQLQAACPADVDPNVALSIDPVTPKVFDNQYFVNLQKGMGLFTSDQVLYSDTRSRPTVDAWAANSSDFQAAFVAAMTNLGRVGVKTDPSLGNIRRDCAVFNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1, 2 and 3), 2 ESTs. Strain="Bd21".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGCGGGGATTAGGCTCCTGGCGGCGCTCCTGGTGCTGGCGTCCGCCGGGACGCCGCGATGCGCGGCGCAGCTCCGGCAGAACTACTACGACGCCGTCTGCCCCGGCGTGGAGAGC
ATCGTGCGCGACGCCGTGGCCAAGAAGGTCAACGACACGCCCGTCGCCGTCGGCGCCACCGTCCGCCTCTTCTTCCACGACTGCTTCGTCCAG
GTCCGTTCCTTTTCCTCTTCCCCCTTT
CCCCTGCCTCAGGGAGGCGCGTATACATTTGGACATTTGGTCGATTTCTGCGTGTGTCAGTTGATTGCCTCTGACGAACTGTACCGGCCGTGAAATGCAGGGCTGTGACGCGTCCGTCAT
CGTGGTGTCGTCGGGGAACAACACGGCGGAGAAGGACCACTCGGCGAACCTCTCGCTGGCCGGCGACGGCTTCGACACGGTCATCAAGGCCAAGGCGGCCGTCGACGCCGTGCCGCAGTG
CACCAACCAGGTCTCCTGCGCGGACATCCTCACCATGGCCACCCGGGATGTCATCGCATTG
GTATGTAGCTGGACTCCGCCTCCTGGAGCCTGCCTGGAGTGGACACACGCCCACTTTAT
TTTTCGAGATCTACCAAAAGTTTCCGGGCTTTTGAGGACATATCTGCAGCTAAAGTCTCTGAAAACTGTGCGTCTTTTTCGGGTTTTTTTTTTCTGCAGGCCGGTGGCCCGGCGTACGCC
GTGGAACTCGGGAGGCTGGACGGGCTGAGCTCGCTGGCGAGCAACGTCGACGGGAACCTGCCGCCGCCGTCGTTCGACCTGGACCAGCTGAACGCCATGTTCACCGCGAACAACCTGTCG
CAGACTGACATGATTGCCCTCTCTG
GTAAGCAATTATTAAAGAGGTTTTTACTGCACTAACCGCCGCCCCAAATTACGCTGCTTTAGCTGCTGTACTAGTCGTTCTGTCGTGCAACCCCA
TGTGCTTTGTTTGTCTGACAAAGTACATTTGTCTAGCAAAGGGCCCTAACGGTGCGATTAATGAAGCATTTCGTGTGCGGCTCAAGAGGTTTGTTGGTAGCAGTAAAAACTGTCGTATCT
CGCCTTGATTAACAGCAGTCTGAGTTTATTTAGGTTCCAGTACACCGAACCTGATAGTGGAGTGTGAGTAGCTGGTCGGTAGATCTGAAAGGAGTCAAACCATGGAGACTAGTACAGCCT
TGCTTGCACGTGAAAGAAAGATCAGCCGTGTGTTATTTTTGTAGCATATCCTTTGCCATAATCGCACCCTGCCAGTTCGCAACCGGGGAAGAGTCCAACTCCCTAATTTCGGCCCATCAT
TCCACAAACTATGGGCCTGCCAAATCAGCACTCTCACTCTAAGGAAACTGCAAATTCTGTCCTAGGTTCAGTCCCATGGATCTTTAAAGCTAGTTCTGCTCCGAAAAATCAAATGTTTTT
TTTGACAGCACAGAAACATCAAATGTTAATGGTACTGGAGTACTGTAGTTACTACGCCTGTCCGTGCCTTCGATTCAAATCTCGATTGACTCAGGAAAAAACAACACTTGTGTTTCTTCA
TTGCAGCGGCGCACACGGTGGGGTTCGCGCACTGCGGCACGTTCGCGGGGCGGATCCAGACGGCGTCCCAGGACCCGACGATGGACTCCGGGTACGCGTCGCAGCTGCAGGCGGCGTGCC
CGGCGGACGTGGACCCGAACGTGGCGCTGTCCATCGACCCGGTGACCCCGAAAGTCTTCGACAACCAGTACTTCGTCAACCTGCAGAAAGGGATGGGCCTCTTCACCTCCGACCAGGTGC
TCTACTCCGACACCCGGTCCCGCCCCACCGTCGACGCCTGGGCGGCCAACAGCTCCGACTTCCAGGCCGCCTTCGTCGCCGCCATGACCAACCTCGGCCGCGTCGGGGTCAAGACCGACC
CGTCCCTGGGCAACATACGCCGCGACTGCGCCGTCTTCAACTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGCGGGGATTAGGCTCCTGGCGGCGCTCCTGGTGCTGGCGTCCGCCGGGACGCCGCGATGCGCGGCGCAGCTCCGGCAGAACTACTACGACGCCGTCTGCCCCGGCGTGGAGAGC
ATCGTGCGCGACGCCGTGGCCAAGAAGGTCAACGACACGCCCGTCGCCGTCGGCGCCACCGTCCGCCTCTTCTTCCACGACTGCTTCGTCCAG
GGCTGTGACGCGTCCGTCATCGTGGTG
TCGTCGGGGAACAACACGGCGGAGAAGGACCACTCGGCGAACCTCTCGCTGGCCGGCGACGGCTTCGACACGGTCATCAAGGCCAAGGCGGCCGTCGACGCCGTGCCGCAGTGCACCAAC
CAGGTCTCCTGCGCGGACATCCTCACCATGGCCACCCGGGATGTCATCGCATTG
GCCGGTGGCCCGGCGTACGCCGTGGAACTCGGGAGGCTGGACGGGCTGAGCTCGCTGGCGAGCAAC
GTCGACGGGAACCTGCCGCCGCCGTCGTTCGACCTGGACCAGCTGAACGCCATGTTCACCGCGAACAACCTGTCGCAGACTGACATGATTGCCCTCTCTG
CGGCGCACACGGTGGGGTTC
GCGCACTGCGGCACGTTCGCGGGGCGGATCCAGACGGCGTCCCAGGACCCGACGATGGACTCCGGGTACGCGTCGCAGCTGCAGGCGGCGTGCCCGGCGGACGTGGACCCGAACGTGGCG
CTGTCCATCGACCCGGTGACCCCGAAAGTCTTCGACAACCAGTACTTCGTCAACCTGCAGAAAGGGATGGGCCTCTTCACCTCCGACCAGGTGCTCTACTCCGACACCCGGTCCCGCCCC
ACCGTCGACGCCTGGGCGGCCAACAGCTCCGACTTCCAGGCCGCCTTCGTCGCCGCCATGACCAACCTCGGCCGCGTCGGGGTCAAGACCGACCCGTCCCTGGGCAACATACGCCGCGAC
TGCGCCGTCTTCAACTCTTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CCGCACAGCC TCCTCTCAAG CTCTCTCAGC GACATCCAAC GGCCTCCGCG TCATCACTAG CTCGCCGCGC TAGACACTGT CATAAGCCAG CCGCACTAGC TTCGATTCGA CGCAGAAGGC  GTCGGGAGAG CTTAGGTAGG TAGCTAGAGG GACGGCATGG GCGCGGGGAT TAGGCTCCTG GCGGCGCTCC TGGTGCTGGC GTCCGCCGGG ACGCCGCGAT GCGCGGCGCA GCTCCGGCAG  AACTACTACG ACGCCGTCTG CCCCGGCGTG GAGAGCATCG TGCGCGACGC CGTGGCCAAG AAGGTCAACG ACACGCCCGT CGCCGTCGGC GCCACCGTCC GCCTCTTCTT CCACGACTGC  TTCGTCCAGG GCTGTGACGC GTCCGTCATC GTGGTGTCGT CGGGGAACAA CACGGCGGAG AAGGACCACT CGGCGAACCT CTCGCTGGCC GGCGACGGCT TCGACACGGT CATCAAGGCC  AAGGCGGCCG TCGACGCCGT GCCGCAGTGC ACCAACCAGG TCTCCTGCGC GGACATCCTC ACCATGGCCA CCCGGGATGT CATCGCATTG GCCGGTGGCC CGGCGTACGC CGTGGAACTC  GGGAGGCTGG ACGGGCTGAG CTCGCTGGCG AGCAACGTCG ACGGGAACCT GCCGCCGCCG TCGTTCGACC TGGACCAGCT GAACGCCATG TTCACCGCGA ACAACCTGTC GCAGACTGAC  ATGATTGCCC TCTCTGCGGC GCACACGGTG GGGTTCGCGC ACTGCGGCAC GTTCGCGGGG CGGATCCAGA CGGCGTCCCA GGACCCGACG ATGGACTCCG GGTACGCGTC GCAGCTGCAG  GCGGCGTGCC CGGCGGACGT GGACCCGAAC GTGGCGCTGT CCATCGACCC GGTGACCCCG AAAGTCTTCG ACAACCAGTA CTTCGTCAAC CTGCAGAAAG GGATGGGCCT CTTCACCTCC  GACCAGGTGC TCTACTCCGA CACCCGGTCC CGCCCCACCG TCGACGCCTG GGCGGCCAAC AGCTCCGACT TCCAGGCCGC CTTCGTCGCC GCCATGACCA ACCTCGGCCG CGTCGGGGTC  AAGACCGACC CGTCCCTGGG CAACATACGC CGCGACTGCG CCGTCTTCAA CTCTTGAATT TGATGTCTGA ATCTTCAATC TTGATACTGC TAGATGGGAT CGATGCGTGG AGATATCATC  AATTGTTCAT AGTTAGTTGG GCCACTTTTG GGTGGTGCTG AAGTTATATA CAGTTAGCTT TTTCAGAACA AAATGTTTTA GTTCTAATCG ATCAGGAGGT TAATGTGAGG CTGTTCGGCA  TTTGTTCTGG AGTTTGTTGG GCATTTTATT ACTTACCTAG CCAAATGTAT TCATTGTGTG TGTGTTTAAT ATTGGAGGAA GAATCATTCG TATGTTTTCT TATGCATTGG TCGATTCGGA 
GAGTTTTGGT ATGGCCAATG AAGTCGGAG 

Retrieve as FASTA