Entry information : BdiPrx12 (Bradi1g20000)
Entry ID 7832
Creation 2011-01-12 (Toky Ramarohetra)
Last sequence changes 2011-01-12 (Toky Ramarohetra)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-08 (Qiang Li)
Peroxidase information: BdiPrx12 (Bradi1g20000)
Name (synonym) BdiPrx12 (Bradi1g20000)
Class Class III peroxidase     [Orthogroup: Prx174]*
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Brachypodium
Organism Brachypodium distachyon    [TaxId: 15368 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdiPrx12
start..stop
S start..stop
SiPrx115 361 1e-123 197..493 1..292
ZmPrx103 355 2e-117 194..493 264..560
SbPrx41 353 4e-116 197..492 326..617
OsPrx106-1 335 3e-112 194..493 90..384
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16001408..16002127 720 N° 2 16002232..16002993 762  
join(16001408..16002127,16002232..16002993)


exon

Literature and cross-references BdiPrx12 (Bradi1g20000)
DNA ref. Phytozome 12:   Bd1 (16001408..16002993)
Protein sequence: BdiPrx12 (Bradi1g20000)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   493
PWM (Da):   %s   50718.43  
PI (pH):   %s   8.19
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVKLAVLTSLLALMLIGSAFSQGAPAYPPSPSPSPVSSDRMTHPPSANPGLPMNPPNVSPSPSLLAYPPTSTGPSRPSPSAPAYPPTTSPPISPPSISIVPSPRSPIQAQPVYPPSSSTPAYEPSPSPSKIAYPPSPSPQSPVPAARSPSPASSPQRSYPPSPSPAPAAVYPPFSAPPINPPSPSPSPTPPSPGLTVGHYKYSCPNAEEIVRQAVKAATDKNLGTGAGLIRLFFHDCFVRGCDASVLLNTTGTGEPTERQGAPNLTLRGFEAIDAAKSALELACPGVVSCADTLAFAARDAAFFLGTGGGGASLLDFAMPAGRRDGRVSLASETVPNLPSPSSTLAQLVARFGAKGLGVGDMVALSGAHSVGRARCSSFSARLAEPSAMDPELARSLWMQCGASGESMVMEDFRTPDVLDAKYYENVVRREVLFGSDAALMASEGTTGMVVENARVSGLWERRFAAAMVRMGAVGAKTGVEDGEIRKKCWIIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1), No EST. Very long PS with multiple repeats AA.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTAAGCTCGCCGTGCTTACTAGCTTGCTTGCATTAATGCTGATCGGTTCTGCGTTCAGCCAAGGTGCGCCTGCTTACCCTCCAAGCCCAAGCCCAAGCCCGGTGAGCTCAGACAGG
ATGACACATCCTCCAAGTGCGAACCCAGGCCTGCCCATGAATCCTCCGAACGTGAGCCCAAGCCCGAGCCTGCTTGCTTATCCTCCTACTAGCACTGGTCCAAGCAGGCCGAGCCCAAGC
GCACCCGCTTATCCACCAACCACAAGCCCACCCATTTCTCCTCCGTCAATTTCGATCGTGCCAAGCCCAAGATCACCCATCCAAGCCCAACCCGTATACCCACCGAGTTCAAGCACACCT
GCTTATGAACCCAGCCCAAGCCCAAGCAAAATCGCTTACCCACCCAGTCCAAGCCCACAGAGCCCGGTCCCTGCTGCTAGGTCACCCAGCCCTGCCTCAAGTCCACAACGGTCTTATCCT
CCTAGCCCTAGCCCTGCCCCAGCAGCCGTGTACCCTCCTTTCTCAGCCCCACCCATTAATCCTCCCAGCCCAAGCCCAAGCCCAACCCCTCCTTCTCCAGGCCTTACCGTGGGCCACTAC
AAGTATTCCTGCCCCAACGCGGAAGAGATCGTCAGGCAGGCCGTGAAGGCCGCCACGGACAAGAACCTGGGCACCGGCGCCGGCCTGATCCGCCTCTTCTTCCACGACTGCTTCGTCCGG
GTAAATAATCTCATACTAACAGAGTATCATCATTCAAAACTAAACGAATTCAATGCGCAGCTCAAGCCAAATCTTAGATTGCGTTTCTGACTAATTAATCACAGGGATGCGACGCTTCGG
TTCTGCTCAACACGACGGGCACCGGCGAGCCGACGGAGCGGCAGGGCGCGCCGAACCTGACGCTCAGGGGCTTCGAGGCCATCGACGCGGCCAAATCGGCGCTCGAGCTCGCGTGCCCGG
GCGTCGTCTCCTGCGCCGACACGCTCGCCTTCGCCGCCCGCGACGCCGCCTTCTTTCTCGGCACCGGCGGCGGCGGCGCGTCCCTCCTCGACTTCGCCATGCCGGCCGGCCGCCGCGACG
GGCGCGTGTCCCTGGCATCCGAGACCGTCCCCAACCTTCCTTCCCCTTCCTCGACCCTGGCCCAGCTCGTGGCCAGGTTCGGCGCCAAGGGGCTCGGCGTGGGCGACATGGTCGCGCTCT
CCGGCGCGCACTCCGTCGGCCGCGCCCGCTGCTCCTCCTTCTCCGCCCGCCTCGCCGAGCCGTCCGCCATGGATCCCGAGCTCGCGAGGTCTCTCTGGATGCAGTGTGGCGCGAGCGGGG
AGTCCATGGTGATGGAGGATTTCAGGACCCCTGACGTGCTCGACGCGAAGTACTACGAGAACGTGGTGCGAAGGGAGGTGCTGTTCGGCTCTGACGCGGCGCTCATGGCGTCGGAGGGCA
CGACGGGGATGGTAGTGGAGAACGCGCGGGTGAGCGGGCTCTGGGAGCGGCGGTTCGCGGCGGCCATGGTCAGGATGGGCGCCGTCGGGGCCAAGACCGGCGTCGAGGATGGGGAGATCA
GGAAGAAATGCTGGATCATCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTAAGCTCGCCGTGCTTACTAGCTTGCTTGCATTAATGCTGATCGGTTCTGCGTTCAGCCAAGGTGCGCCTGCTTACCCTCCAAGCCCAAGCCCAAGCCCGGTGAGCTCAGACAGG
ATGACACATCCTCCAAGTGCGAACCCAGGCCTGCCCATGAATCCTCCGAACGTGAGCCCAAGCCCGAGCCTGCTTGCTTATCCTCCTACTAGCACTGGTCCAAGCAGGCCGAGCCCAAGC
GCACCCGCTTATCCACCAACCACAAGCCCACCCATTTCTCCTCCGTCAATTTCGATCGTGCCAAGCCCAAGATCACCCATCCAAGCCCAACCCGTATACCCACCGAGTTCAAGCACACCT
GCTTATGAACCCAGCCCAAGCCCAAGCAAAATCGCTTACCCACCCAGTCCAAGCCCACAGAGCCCGGTCCCTGCTGCTAGGTCACCCAGCCCTGCCTCAAGTCCACAACGGTCTTATCCT
CCTAGCCCTAGCCCTGCCCCAGCAGCCGTGTACCCTCCTTTCTCAGCCCCACCCATTAATCCTCCCAGCCCAAGCCCAAGCCCAACCCCTCCTTCTCCAGGCCTTACCGTGGGCCACTAC
AAGTATTCCTGCCCCAACGCGGAAGAGATCGTCAGGCAGGCCGTGAAGGCCGCCACGGACAAGAACCTGGGCACCGGCGCCGGCCTGATCCGCCTCTTCTTCCACGACTGCTTCGTCCGG
GGATGCGACGCTTCGGTTCTGCTCAACACGACGGGCACCGGCGAGCCGACGGAGCGGCAGGGCGCGCCGAACCTGACGCTCAGGGGCTTCGAGGCCATCGACGCGGCCAAATCGGCGCTC
GAGCTCGCGTGCCCGGGCGTCGTCTCCTGCGCCGACACGCTCGCCTTCGCCGCCCGCGACGCCGCCTTCTTTCTCGGCACCGGCGGCGGCGGCGCGTCCCTCCTCGACTTCGCCATGCCG
GCCGGCCGCCGCGACGGGCGCGTGTCCCTGGCATCCGAGACCGTCCCCAACCTTCCTTCCCCTTCCTCGACCCTGGCCCAGCTCGTGGCCAGGTTCGGCGCCAAGGGGCTCGGCGTGGGC
GACATGGTCGCGCTCTCCGGCGCGCACTCCGTCGGCCGCGCCCGCTGCTCCTCCTTCTCCGCCCGCCTCGCCGAGCCGTCCGCCATGGATCCCGAGCTCGCGAGGTCTCTCTGGATGCAG
TGTGGCGCGAGCGGGGAGTCCATGGTGATGGAGGATTTCAGGACCCCTGACGTGCTCGACGCGAAGTACTACGAGAACGTGGTGCGAAGGGAGGTGCTGTTCGGCTCTGACGCGGCGCTC
ATGGCGTCGGAGGGCACGACGGGGATGGTAGTGGAGAACGCGCGGGTGAGCGGGCTCTGGGAGCGGCGGTTCGCGGCGGCCATGGTCAGGATGGGCGCCGTCGGGGCCAAGACCGGCGTC
GAGGATGGGGAGATCAGGAAGAAATGCTGGATCATCAACTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTAAGC TCGCCGTGCT TACTAGCTTG CTTGCATTAA TGCTGATCGG TTCTGCGTTC AGCCAAGGTG CGCCTGCTTA CCCTCCAAGC CCAAGCCCAA GCCCGGTGAG CTCAGACAGG  ATGACACATC CTCCAAGTGC GAACCCAGGC CTGCCCATGA ATCCTCCGAA CGTGAGCCCA AGCCCGAGCC TGCTTGCTTA TCCTCCTACT AGCACTGGTC CAAGCAGGCC GAGCCCAAGC  GCACCCGCTT ATCCACCAAC CACAAGCCCA CCCATTTCTC CTCCGTCAAT TTCGATCGTG CCAAGCCCAA GATCACCCAT CCAAGCCCAA CCCGTATACC CACCGAGTTC AAGCACACCT  GCTTATGAAC CCAGCCCAAG CCCAAGCAAA ATCGCTTACC CACCCAGTCC AAGCCCACAG AGCCCGGTCC CTGCTGCTAG GTCACCCAGC CCTGCCTCAA GTCCACAACG GTCTTATCCT  CCTAGCCCTA GCCCTGCCCC AGCAGCCGTG TACCCTCCTT TCTCAGCCCC ACCCATTAAT CCTCCCAGCC CAAGCCCAAG CCCAACCCCT CCTTCTCCAG GCCTTACCGT GGGCCACTAC  AAGTATTCCT GCCCCAACGC GGAAGAGATC GTCAGGCAGG CCGTGAAGGC CGCCACGGAC AAGAACCTGG GCACCGGCGC CGGCCTGATC CGCCTCTTCT TCCACGACTG CTTCGTCCGG  GGATGCGACG CTTCGGTTCT GCTCAACACG ACGGGCACCG GCGAGCCGAC GGAGCGGCAG GGCGCGCCGA ACCTGACGCT CAGGGGCTTC GAGGCCATCG ACGCGGCCAA ATCGGCGCTC  GAGCTCGCGT GCCCGGGCGT CGTCTCCTGC GCCGACACGC TCGCCTTCGC CGCCCGCGAC GCCGCCTTCT TTCTCGGCAC CGGCGGCGGC GGCGCGTCCC TCCTCGACTT CGCCATGCCG  GCCGGCCGCC GCGACGGGCG CGTGTCCCTG GCATCCGAGA CCGTCCCCAA CCTTCCTTCC CCTTCCTCGA CCCTGGCCCA GCTCGTGGCC AGGTTCGGCG CCAAGGGGCT CGGCGTGGGC  GACATGGTCG CGCTCTCCGG CGCGCACTCC GTCGGCCGCG CCCGCTGCTC CTCCTTCTCC GCCCGCCTCG CCGAGCCGTC CGCCATGGAT CCCGAGCTCG CGAGGTCTCT CTGGATGCAG  TGTGGCGCGA GCGGGGAGTC CATGGTGATG GAGGATTTCA GGACCCCTGA CGTGCTCGAC GCGAAGTACT ACGAGAACGT GGTGCGAAGG GAGGTGCTGT TCGGCTCTGA CGCGGCGCTC  ATGGCGTCGG AGGGCACGAC GGGGATGGTA GTGGAGAACG CGCGGGTGAG CGGGCTCTGG GAGCGGCGGT TCGCGGCGGC CATGGTCAGG ATGGGCGCCG TCGGGGCCAA GACCGGCGTC  GAGGATGGGG AGATCAGGAA GAAATGCTGG ATCATCAACT AGCTGCTCGC TGCTAGTACG TGTGGGTGTG ATGGTCTTTT GTGATTGTGT ACCACATTAA TTTATCTATT CTATTCGTTG 
CATTTGCATA GTGATTTCGC TTTCTGAATT CTGATGCCCG GGATTCAGGG TATTTGTTGA CGTTGAAATA GGTACAGACA TATACAGTTA 

Retrieve as FASTA